BLASTX nr result
ID: Cocculus23_contig00030640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00030640 (553 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45383.1| hypothetical protein MIMGU_mgv1a023657mg [Mimulus... 45 2e-06 ref|XP_006350917.1| PREDICTED: pentatricopeptide repeat-containi... 42 9e-06 >gb|EYU45383.1| hypothetical protein MIMGU_mgv1a023657mg [Mimulus guttatus] Length = 701 Score = 45.1 bits (105), Expect(2) = 2e-06 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = +2 Query: 125 RYFQDHPILSLLERCSTTAQLKQIHVYIVGCG 220 RYF +HP ++L+E+CS + QLKQIH ++ CG Sbjct: 18 RYFANHPTVTLIEKCSNSRQLKQIHAQMLRCG 49 Score = 32.7 bits (73), Expect(2) = 2e-06 Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 3/34 (8%) Frame = +3 Query: 216 AAIKLLQGWLWP---SLDYAR*VFDQMPQPNLYT 308 +A KL+Q + SL YA VFDQ+PQPNLY+ Sbjct: 56 SASKLVQSYALSELSSLHYAYKVFDQIPQPNLYS 89 >ref|XP_006350917.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum tuberosum] Length = 744 Score = 42.4 bits (98), Expect(2) = 9e-06 Identities = 15/32 (46%), Positives = 25/32 (78%) Frame = +2 Query: 125 RYFQDHPILSLLERCSTTAQLKQIHVYIVGCG 220 RYF++HP++ L+++C + QLKQIH Y++ G Sbjct: 31 RYFENHPLVLLIDKCQSIKQLKQIHAYMLRIG 62 Score = 32.7 bits (73), Expect(2) = 9e-06 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = +3 Query: 252 SLDYAR*VFDQMPQPNLYT 308 SLDYA VFD++PQPNL++ Sbjct: 84 SLDYAHKVFDEIPQPNLFS 102