BLASTX nr result
ID: Cocculus23_contig00030451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00030451 (254 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_054522.1| ribosomal protein L33 [Nicotiana tabacum] gi|28... 88 1e-15 ref|YP_817503.1| ribosomal protein L33 [Coffea arabica] gi|12215... 87 2e-15 ref|YP_007317269.1| ribosomal protein L33 (chloroplast) [Camelli... 87 3e-15 ref|YP_086987.1| ribosomal protein L33 [Panax ginseng] gi|558602... 87 3e-15 gb|ADM92731.1| ribosomal protein L33 [Franklinia alatamaha] 87 3e-15 gb|ADD30177.1| ribosomal protein L33 [Ilex cornuta] 87 3e-15 ref|YP_538869.1| ribosomal protein L33 [Solanum bulbocastanum] g... 86 4e-15 ref|YP_398350.1| ribosomal protein L33 [Lactuca sativa] gi|12221... 86 4e-15 ref|YP_005089428.1| rpl33 gene product (chloroplast) [Silene noc... 86 4e-15 ref|YP_538956.1| ribosomal protein L33 [Gossypium hirsutum] gi|1... 86 5e-15 ref|YP_005089598.1| rpl33 gene product (chloroplast) [Silene lat... 86 5e-15 ref|YP_008081386.1| ribosomal protein L33 (chloroplast) [Tetrace... 86 7e-15 ref|YP_053176.1| ribosomal protein L33 [Nymphaea alba] gi|680531... 86 7e-15 ref|YP_006666051.1| ribosomal protein L33 (chloroplast) [Capsicu... 86 7e-15 ref|YP_004935573.1| ribosomal protein L33 (chloroplast) [Eleuthe... 86 7e-15 ref|YP_008081478.1| ribosomal protein L33 (chloroplast) [Trochod... 86 7e-15 ref|YP_001294119.1| ribosomal protein L33 [Chloranthus spicatus]... 86 7e-15 ref|YP_001001555.1| ribosomal protein L33 [Nuphar advena] gi|692... 86 7e-15 ref|YP_009020764.1| ribosomal protein L33 (chloroplast) [Praxeli... 85 9e-15 gb|AGW97972.1| ribosomal protein L33 (chloroplast) [Ipomoea setosa] 85 9e-15 >ref|NP_054522.1| ribosomal protein L33 [Nicotiana tabacum] gi|28261738|ref|NP_783253.1| ribosomal protein L33 [Atropa belladonna] gi|78102559|ref|YP_358700.1| ribosomal protein L33 [Nicotiana sylvestris] gi|81301589|ref|YP_398886.1| ribosomal protein L33 [Nicotiana tomentosiformis] gi|351653903|ref|YP_004891628.1| rpl33 gene product (chloroplast) [Nicotiana undulata] gi|394831122|ref|YP_006503812.1| ribosomal protein L33 (chloroplast) [Datura stramonium] gi|132901|sp|P06393.3|RK33_TOBAC RecName: Full=50S ribosomal protein L33, chloroplastic gi|68053184|sp|Q7FNS6.1|RK33_ATRBE RecName: Full=50S ribosomal protein L33, chloroplastic gi|122212891|sp|Q33C11.1|RK33_NICTO RecName: Full=50S ribosomal protein L33, chloroplastic gi|122213566|sp|Q3C1K8.1|RK33_NICSY RecName: Full=50S ribosomal protein L33, chloroplastic gi|11850|emb|CAA77370.1| ribosomal protein L33 [Nicotiana tabacum] gi|20068352|emb|CAC88065.1| ribosomal protein L33 [Atropa belladonna] gi|77799586|dbj|BAE46675.1| ribosomal protein L33 [Nicotiana sylvestris] gi|80750948|dbj|BAE48024.1| ribosomal protein L33 [Nicotiana tomentosiformis] gi|347453929|gb|AEO95587.1| ribosomal protein L33 (chloroplast) [Nicotiana undulata] gi|347454040|gb|AEO95697.1| ribosomal protein L33 [synthetic construct] gi|350996447|gb|AEQ36959.1| ribosomal protein L33 (chloroplast) [Datura stramonium] gi|350996533|gb|AEQ37044.1| ribosomal protein L33 [Datura stramonium] gi|225219|prf||1211235BA ribosomal protein L33 Length = 66 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK Sbjct: 29 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 66 >ref|YP_817503.1| ribosomal protein L33 [Coffea arabica] gi|122153641|sp|A0A356.1|RK33_COFAR RecName: Full=50S ribosomal protein L33, chloroplastic gi|116242185|gb|ABJ89700.1| ribosomal protein L33 [Coffea arabica] Length = 66 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTPNRLELKKFCPYCYKHT+HGEIKK Sbjct: 29 GISRYITQKNRHNTPNRLELKKFCPYCYKHTVHGEIKK 66 >ref|YP_007317269.1| ribosomal protein L33 (chloroplast) [Camellia sinensis] gi|552539653|ref|YP_008592778.1| 50S ribosomal protein L33 (chloroplast) [Camellia cuspidata] gi|552540900|ref|YP_008592865.1| 50S ribosomal protein L33 (chloroplast) [Camellia danzaiensis] gi|552540995|ref|YP_008592954.1| 50S ribosomal protein L33 (chloroplast) [Camellia impressinervis] gi|552541089|ref|YP_008593132.1| 50S ribosomal protein L33 (chloroplast) [Camellia yunnanensis] gi|552546248|ref|YP_008593043.1| 50S ribosomal protein L33 (chloroplast) [Camellia pitardii] gi|568244580|ref|YP_008963327.1| ribosomal protein L33 [Camellia oleifera] gi|388893228|gb|AFK81320.1| ribosomal protein L33 [Camellia sinensis var. assamica] gi|388893316|gb|AFK81407.1| ribosomal protein L33 [Camellia oleifera] gi|430728293|gb|AGA55617.1| ribosomal protein L33 (chloroplast) [Camellia sinensis] gi|537362471|gb|AGU44279.1| 50S ribosomal protein L33 (chloroplast) [Camellia cuspidata] gi|537362559|gb|AGU44366.1| 50S ribosomal protein L33 (chloroplast) [Camellia danzaiensis] gi|537362649|gb|AGU44455.1| 50S ribosomal protein L33 (chloroplast) [Camellia impressinervis] gi|537362829|gb|AGU44633.1| 50S ribosomal protein L33 (chloroplast) [Camellia pitardii] gi|537362919|gb|AGU44722.1| 50S ribosomal protein L33 (chloroplast) [Camellia yunnanensis] gi|555945937|gb|AGZ19164.1| ribosomal protein L33 (chloroplast) [Camellia sinensis] Length = 66 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTPNRLEL+KFCPYCYKHTIHGEIKK Sbjct: 29 GISRYITQKNRHNTPNRLELRKFCPYCYKHTIHGEIKK 66 >ref|YP_086987.1| ribosomal protein L33 [Panax ginseng] gi|558602933|ref|YP_008814964.1| ribosomal protein L33 (chloroplast) [Brassaiopsis hainla] gi|558603021|ref|YP_008815051.1| ribosomal protein L33 (chloroplast) [Metapanax delavayi] gi|558603109|ref|YP_008815138.1| ribosomal protein L33 (chloroplast) [Schefflera delavayi] gi|563940300|ref|YP_008814877.1| ribosomal protein L33 (chloroplast) [Aralia undulata] gi|68053098|sp|Q68RY5.1|RK33_PANGI RecName: Full=50S ribosomal protein L33, chloroplastic gi|51235334|gb|AAT98530.1| ribosomal protein L33 [Panax ginseng] gi|458599111|gb|AGG38977.1| ribosomal protein L33 (chloroplast) [Aralia undulata] gi|458599213|gb|AGG39064.1| ribosomal protein L33 (chloroplast) [Brassaiopsis hainla] gi|458599392|gb|AGG39151.1| ribosomal protein L33 (chloroplast) [Metapanax delavayi] gi|458599545|gb|AGG39238.1| ribosomal protein L33 (chloroplast) [Schefflera delavayi] gi|506444450|gb|AGM15012.1| ribosomal protein L33 (chloroplast) [Panax ginseng] gi|506444538|gb|AGM15098.1| ribosomal protein L33 (chloroplast) [Panax ginseng] gi|506444654|gb|AGM15184.1| ribosomal protein L33 (chloroplast) [Panax ginseng] Length = 66 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTPNRLEL+KFCPYCYKHTIHGEIKK Sbjct: 29 GISRYITQKNRHNTPNRLELRKFCPYCYKHTIHGEIKK 66 >gb|ADM92731.1| ribosomal protein L33 [Franklinia alatamaha] Length = 66 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTPNRLEL+KFCPYCYKHTIHGEIKK Sbjct: 29 GISRYITQKNRHNTPNRLELRKFCPYCYKHTIHGEIKK 66 >gb|ADD30177.1| ribosomal protein L33 [Ilex cornuta] Length = 66 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTPNRLEL+KFCPYCYKHTIHGEIKK Sbjct: 29 GISRYITQKNRHNTPNRLELRKFCPYCYKHTIHGEIKK 66 >ref|YP_538869.1| ribosomal protein L33 [Solanum bulbocastanum] gi|108773151|ref|YP_635660.1| ribosomal protein L33 [Solanum tuberosum] gi|544163634|ref|YP_008563109.1| ribosomal protein L33 (chloroplast) [Solanum lycopersicum] gi|544170692|ref|AP_004949.1| ribosomal protein L33 (chloroplast) [Solanum lycopersicum] gi|122201773|sp|Q2MI79.1|RK33_SOLLC RecName: Full=50S ribosomal protein L33, chloroplastic gi|122201815|sp|Q2MIG6.1|RK33_SOLBU RecName: Full=50S ribosomal protein L33, chloroplastic gi|122209882|sp|Q2VEF7.1|RK33_SOLTU RecName: Full=50S ribosomal protein L33, chloroplastic gi|82754647|gb|ABB90061.1| ribosomal protein L33 [Solanum tuberosum] gi|84371916|gb|ABC56234.1| ribosomal protein L33 [Solanum bulbocastanum] gi|84372004|gb|ABC56321.1| ribosomal protein L33 (chloroplast) [Solanum lycopersicum] gi|88656825|gb|ABD47078.1| ribosomal protein L33 [Solanum tuberosum] gi|89241692|emb|CAJ32414.1| ribosomal protein L33 [Solanum lycopersicum] gi|329124603|gb|AEB72160.1| ribosomal protein L33 (chloroplast) [Solanum tuberosum] gi|329124690|gb|AEB72246.1| ribosomal protein L33 (chloroplast) [Solanum tuberosum] gi|478733663|gb|AGJ51274.1| ribosomal protein L33 (chloroplast) [Solanum carolinense] Length = 66 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTPNR ELKKFCPYCYKHTIHGEIKK Sbjct: 29 GISRYITQKNRHNTPNRFELKKFCPYCYKHTIHGEIKK 66 >ref|YP_398350.1| ribosomal protein L33 [Lactuca sativa] gi|122212019|sp|Q332V7.1|RK33_LACSA RecName: Full=50S ribosomal protein L33, chloroplastic gi|78675189|dbj|BAE47615.1| ribosomal protein L33 [Lactuca sativa] gi|88657004|gb|ABD47254.1| ribosomal protein L33 (chloroplast) [Lactuca sativa] Length = 68 Score = 86.3 bits (212), Expect = 4e-15 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTPNRLEL+KFCPYCYKHTIHGE+KK Sbjct: 31 GISRYITQKNRHNTPNRLELRKFCPYCYKHTIHGEVKK 68 >ref|YP_005089428.1| rpl33 gene product (chloroplast) [Silene noctiflora] gi|329755616|gb|AEC04178.1| ribosomal protein L33 (chloroplast) [Silene noctiflora] Length = 66 Score = 86.3 bits (212), Expect = 4e-15 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 G+SRYITQKNRHNTPNRLEL+KFCPYCYKHTIHGEIKK Sbjct: 29 GVSRYITQKNRHNTPNRLELRKFCPYCYKHTIHGEIKK 66 >ref|YP_538956.1| ribosomal protein L33 [Gossypium hirsutum] gi|119368520|ref|YP_913208.1| ribosomal protein L33 [Gossypium barbadense] gi|313199723|ref|YP_004021337.1| ribosomal protein L33 [Theobroma cacao] gi|325210950|ref|YP_004286025.1| ribosomal protein L33 [Gossypium thurberi] gi|372290952|ref|YP_005087714.1| ribosomal protein L33 (chloroplast) [Gossypium raimondii] gi|372291053|ref|YP_005087810.1| ribosomal protein L33 (chloroplast) [Gossypium darwinii] gi|372291407|ref|YP_005088301.1| ribosomal protein L33 (chloroplast) [Gossypium tomentosum] gi|372291505|ref|YP_005088397.1| ribosomal protein L33 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|372291795|ref|YP_005088937.1| ribosomal protein L33 (chloroplast) [Gossypium mustelinum] gi|372291879|ref|YP_005089020.1| ribosomal protein L33 (chloroplast) [Gossypium arboreum] gi|386800859|ref|YP_006303512.1| ribosomal protein L33 (chloroplast) [Gossypium gossypioides] gi|394830648|ref|YP_006503298.1| ribosomal protein L33 (chloroplast) [Gossypium incanum] gi|394830735|ref|YP_006503381.1| ribosomal protein L33 (chloroplast) [Gossypium somalense] gi|394830821|ref|YP_006503464.1| ribosomal protein L33 (chloroplast) [Gossypium capitis-viridis] gi|394830910|ref|YP_006503547.1| ribosomal protein L33 (chloroplast) [Gossypium areysianum] gi|394830997|ref|YP_006503630.1| ribosomal protein L33 (chloroplast) [Gossypium robinsonii] gi|570758901|ref|YP_008992485.1| ribosomal protein L33 (chloroplast) [Gossypium anomalum] gi|570758989|ref|YP_008992571.1| ribosomal protein L33 (chloroplast) [Gossypium bickii] gi|570759077|ref|YP_008992916.1| ribosomal protein L33 (chloroplast) [Gossypium sturtianum] gi|570759597|ref|YP_008992658.1| ribosomal protein L33 (chloroplast) [Gossypium herbaceum] gi|570759683|ref|YP_008992744.1| ribosomal protein L33 (chloroplast) [Gossypium longicalyx] gi|570879934|ref|YP_008992830.1| ribosomal protein L33 (chloroplast) [Gossypium stocksii] gi|122201404|sp|Q2L929.1|RK33_GOSHI RecName: Full=50S ribosomal protein L33, chloroplastic gi|125987612|sp|A0ZZ56.1|RK33_GOSBA RecName: Full=50S ribosomal protein L33, chloroplastic gi|85687437|gb|ABC73649.1| ribosomal protein L33 [Gossypium hirsutum] gi|119224882|dbj|BAF41268.1| Ribosomal protein L33 [Gossypium barbadense] gi|290775812|gb|ADD62308.1| ribosomal protein L33 [Gossypium thurberi] gi|309321287|gb|ADO64830.1| ribosomal protein L33 [Theobroma cacao] gi|318084338|gb|ADV38814.1| ribosomal protein L33 (chloroplast) [Gossypium arboreum] gi|318084421|gb|ADV38896.1| ribosomal protein L33 (chloroplast) [Gossypium darwinii] gi|318084506|gb|ADV38980.1| ribosomal protein L33 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|318084590|gb|ADV39063.1| ribosomal protein L33 (chloroplast) [Gossypium mustelinum] gi|318084670|gb|ADV39142.1| ribosomal protein L33 (chloroplast) [Gossypium raimondii] gi|318084758|gb|ADV39229.1| ribosomal protein L33 (chloroplast) [Gossypium tomentosum] gi|326457060|gb|ADZ74324.1| ribosomal protein L33 [Gossypium anomalum] gi|326457148|gb|ADZ74411.1| ribosomal protein L33 [Gossypium bickii] gi|326457236|gb|ADZ74498.1| ribosomal protein L33 [Gossypium herbaceum] gi|326457322|gb|ADZ74583.1| ribosomal protein L33 [Gossypium longicalyx] gi|326457409|gb|ADZ74669.1| ribosomal protein L33 [Gossypium stocksii] gi|326457497|gb|ADZ74756.1| ribosomal protein L33 [Gossypium sturtianum] gi|328924801|gb|ADO64911.2| ribosomal protein L33 [Theobroma cacao] gi|329317093|gb|AEB90452.1| ribosomal protein L33 (chloroplast) [Gossypium gossypioides] gi|329317177|gb|AEB90535.1| ribosomal protein L33 (chloroplast) [Gossypium hirsutum] gi|329317261|gb|AEB90618.1| ribosomal protein L33 (chloroplast) [Gossypium hirsutum] gi|329317345|gb|AEB90701.1| ribosomal protein L33 (chloroplast) [Gossypium barbadense] gi|329317429|gb|AEB90784.1| ribosomal protein L33 (chloroplast) [Gossypium barbadense] gi|329317513|gb|AEB90867.1| ribosomal protein L33 (chloroplast) [Gossypium barbadense] gi|335354353|gb|AEH42973.1| ribosomal protein L33 [Gossypium incanum] gi|335354437|gb|AEH43056.1| ribosomal protein L33 [Gossypium somalense] gi|335354521|gb|AEH43139.1| ribosomal protein L33 (chloroplast) [Gossypium capitis-viridis] gi|335354605|gb|AEH43222.1| ribosomal protein L33 (chloroplast) [Gossypium areysianum] gi|335354689|gb|AEH43305.1| ribosomal protein L33 [Gossypium robinsonii] gi|371925957|gb|AEX57747.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926039|gb|AEX57828.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926121|gb|AEX57909.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926203|gb|AEX57990.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926285|gb|AEX58071.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926367|gb|AEX58152.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926449|gb|AEX58233.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926531|gb|AEX58314.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926613|gb|AEX58395.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926695|gb|AEX58476.1| ribosomal protein L33 (chloroplast) [Theobroma grandiflorum] gi|371926777|gb|AEX58557.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] Length = 66 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTP+RLELKKFCPYCYKHTIHGEIKK Sbjct: 29 GISRYITQKNRHNTPSRLELKKFCPYCYKHTIHGEIKK 66 >ref|YP_005089598.1| rpl33 gene product (chloroplast) [Silene latifolia] gi|166235722|gb|ABY85629.1| ribosomal protein L33 [Silene latifolia] gi|329755542|gb|AEC04105.1| ribosomal protein L33 (chloroplast) [Silene latifolia] Length = 66 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 G+SRYITQKNRHNTPNRLE KKFCPYCYKHTIHGEIKK Sbjct: 29 GVSRYITQKNRHNTPNRLEFKKFCPYCYKHTIHGEIKK 66 >ref|YP_008081386.1| ribosomal protein L33 (chloroplast) [Tetracentron sinense] gi|479279224|gb|AGJ72078.1| ribosomal protein L33 (chloroplast) [Tetracentron sinense] Length = 66 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTP RLELKKFCPYCYKHTIHGEIKK Sbjct: 29 GISRYITQKNRHNTPGRLELKKFCPYCYKHTIHGEIKK 66 >ref|YP_053176.1| ribosomal protein L33 [Nymphaea alba] gi|68053162|sp|Q6EW32.1|RK33_NYMAL RecName: Full=50S ribosomal protein L33, chloroplastic gi|50250348|emb|CAF28614.1| ribosomal protein L33 [Nymphaea alba] Length = 68 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTP RLELKKFCPYCYKHTIHGEIKK Sbjct: 31 GISRYITQKNRHNTPGRLELKKFCPYCYKHTIHGEIKK 68 >ref|YP_006666051.1| ribosomal protein L33 (chloroplast) [Capsicum annuum] gi|401065953|gb|AFP90797.1| ribosomal protein L33 (chloroplast) [Capsicum annuum] Length = 66 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRY TQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK Sbjct: 29 GISRYSTQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 66 >ref|YP_004935573.1| ribosomal protein L33 (chloroplast) [Eleutherococcus senticosus] gi|347448228|gb|AEO92640.1| ribosomal protein L33 (chloroplast) [Eleutherococcus senticosus] Length = 66 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQ+NRHNTPNRLEL+KFCPYCYKHTIHGEIKK Sbjct: 29 GISRYITQRNRHNTPNRLELRKFCPYCYKHTIHGEIKK 66 >ref|YP_008081478.1| ribosomal protein L33 (chloroplast) [Trochodendron aralioides] gi|290487622|gb|ADD30195.1| ribosomal protein L33 [Trochodendron aralioides] gi|479279317|gb|AGJ72170.1| ribosomal protein L33 (chloroplast) [Trochodendron aralioides] Length = 66 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTP RLELKKFCPYCYKHTIHGEIKK Sbjct: 29 GISRYITQKNRHNTPGRLELKKFCPYCYKHTIHGEIKK 66 >ref|YP_001294119.1| ribosomal protein L33 [Chloranthus spicatus] gi|218546841|sp|A6MME3.1|RK33_CHLSC RecName: Full=50S ribosomal protein L33, chloroplastic gi|146744209|gb|ABQ43281.1| ribosomal protein L33 [Chloranthus spicatus] Length = 66 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQ+NRHNTPNRLEL+KFCPYCYKHTIHGEIKK Sbjct: 29 GISRYITQRNRHNTPNRLELRKFCPYCYKHTIHGEIKK 66 >ref|YP_001001555.1| ribosomal protein L33 [Nuphar advena] gi|69216040|gb|AAZ03879.1| ribosomal protein L33 [Nuphar advena] gi|84682225|gb|ABC60479.1| ribosomal protein L33 [Nuphar advena] Length = 68 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTP RLELKKFCPYCYKHTIHGEIKK Sbjct: 31 GISRYITQKNRHNTPGRLELKKFCPYCYKHTIHGEIKK 68 >ref|YP_009020764.1| ribosomal protein L33 (chloroplast) [Praxelis clematidea] gi|594543343|gb|AHM02424.1| ribosomal protein L33 (chloroplast) [Praxelis clematidea] Length = 66 Score = 85.1 bits (209), Expect = 9e-15 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTPNRLEL KFCPYCYKHTIHGEIKK Sbjct: 29 GISRYITQKNRHNTPNRLELLKFCPYCYKHTIHGEIKK 66 >gb|AGW97972.1| ribosomal protein L33 (chloroplast) [Ipomoea setosa] Length = 66 Score = 85.1 bits (209), Expect = 9e-15 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 GISRYITQKNRHNTPNRLELKKFCPYCYKHTIHGEIKK 115 GISRYITQKNRHNTPN LELKKFCPYCYKHTIHGEIKK Sbjct: 29 GISRYITQKNRHNTPNPLELKKFCPYCYKHTIHGEIKK 66