BLASTX nr result
ID: Cocculus23_contig00030378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00030378 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006355831.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-12 ref|XP_006604759.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-11 ref|XP_006604760.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-11 ref|XP_007163239.1| hypothetical protein PHAVU_001G217700g [Phas... 62 7e-11 ref|XP_004240647.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-10 ref|XP_006394465.1| hypothetical protein EUTSA_v10005291mg [Eutr... 55 3e-09 ref|XP_004239364.1| PREDICTED: pentatricopeptide repeat-containi... 46 3e-08 emb|CAN67319.1| hypothetical protein VITISV_039344 [Vitis vinifera] 50 4e-08 ref|XP_004292461.1| PREDICTED: pentatricopeptide repeat-containi... 45 6e-08 ref|NP_197403.2| mitochondrial editing factor 18 [Arabidopsis th... 52 6e-08 ref|XP_002278375.1| PREDICTED: pentatricopeptide repeat-containi... 50 6e-08 tpg|DAA61013.1| TPA: hypothetical protein ZEAMMB73_343744 [Zea m... 49 6e-08 ref|XP_002873924.1| pentatricopeptide repeat-containing protein ... 52 7e-08 ref|XP_002278668.2| PREDICTED: pentatricopeptide repeat-containi... 57 7e-08 emb|CBI16904.3| unnamed protein product [Vitis vinifera] 57 7e-08 ref|XP_007216989.1| hypothetical protein PRUPE_ppa002640mg [Prun... 45 7e-08 ref|XP_004503293.1| PREDICTED: pentatricopeptide repeat-containi... 41 1e-07 gb|EMT29065.1| hypothetical protein F775_00619 [Aegilops tauschii] 47 2e-07 ref|XP_006357212.1| PREDICTED: pentatricopeptide repeat-containi... 45 2e-07 ref|XP_004144924.1| PREDICTED: pentatricopeptide repeat-containi... 49 2e-07 >ref|XP_006355831.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum tuberosum] Length = 529 Score = 62.0 bits (149), Expect(2) = 4e-12 Identities = 27/53 (50%), Positives = 38/53 (71%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEMGRTG 394 G + L Q A++LFD+MPHRDV+SWN+MLSG+ +N+ E + FL+M R G Sbjct: 59 GYFKHNLIQQAEYLFDKMPHRDVVSWNTMLSGYRNANNPEKVYRCFLDMNRCG 111 Score = 34.7 bits (78), Expect(2) = 4e-12 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +1 Query: 175 KLFDQNPELGDVTTWNIMIIGYCK 246 KLFDQ+P L +V +WN +I GY K Sbjct: 39 KLFDQSPHLTNVVSWNSLIAGYFK 62 >ref|XP_006604759.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like isoform X1 [Glycine max] Length = 531 Score = 60.1 bits (144), Expect(2) = 3e-11 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +2 Query: 260 QHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEMGRTG 394 Q+AQ+LFDQMP +D +SWN MLSGF+R + + L FL+MGR G Sbjct: 73 QYAQYLFDQMPFKDTVSWNIMLSGFHRITNSDGLYRCFLQMGRAG 117 Score = 33.5 bits (75), Expect(2) = 3e-11 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 175 KLFDQNPELGDVTTWNIMIIGYCK 246 KLFD+NP ++ +WN+M+ GY K Sbjct: 45 KLFDENPSSRNLVSWNMMMTGYVK 68 >ref|XP_006604760.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like isoform X2 [Glycine max] Length = 299 Score = 60.1 bits (144), Expect(2) = 3e-11 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +2 Query: 260 QHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEMGRTG 394 Q+AQ+LFDQMP +D +SWN MLSGF+R + + L FL+MGR G Sbjct: 73 QYAQYLFDQMPFKDTVSWNIMLSGFHRITNSDGLYRCFLQMGRAG 117 Score = 33.5 bits (75), Expect(2) = 3e-11 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 175 KLFDQNPELGDVTTWNIMIIGYCK 246 KLFD+NP ++ +WN+M+ GY K Sbjct: 45 KLFDENPSSRNLVSWNMMMTGYVK 68 >ref|XP_007163239.1| hypothetical protein PHAVU_001G217700g [Phaseolus vulgaris] gi|561036703|gb|ESW35233.1| hypothetical protein PHAVU_001G217700g [Phaseolus vulgaris] Length = 561 Score = 61.6 bits (148), Expect(2) = 7e-11 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = +2 Query: 260 QHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEMGRTG 394 +HA +LFDQMP +D +SWN MLSGF R D E L +FL+MGR+G Sbjct: 105 EHAHNLFDQMPLKDTVSWNIMLSGFSRITDSEGLYRHFLQMGRSG 149 Score = 30.8 bits (68), Expect(2) = 7e-11 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 175 KLFDQNPELGDVTTWNIMIIGYCK 246 KLFD NP ++ +WN+M+ G+ K Sbjct: 77 KLFDDNPSSRNLVSWNMMMTGHVK 100 >ref|XP_004240647.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Solanum lycopersicum] Length = 630 Score = 58.9 bits (141), Expect(2) = 3e-10 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEMGRTG 394 G + L Q A++LFD+MPHRDV+SWN+MLSG+ +N+ + FL+M R G Sbjct: 59 GYFKHNLIQKAEYLFDKMPHRDVVSWNTMLSGYRNANNPGKVYRCFLDMNRCG 111 Score = 31.2 bits (69), Expect(2) = 3e-10 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 175 KLFDQNPELGDVTTWNIMIIGYCK 246 K FDQ+P L +V +WN + GY K Sbjct: 39 KFFDQSPHLTNVVSWNSLTAGYFK 62 >ref|XP_006394465.1| hypothetical protein EUTSA_v10005291mg [Eutrema salsugineum] gi|557091104|gb|ESQ31751.1| hypothetical protein EUTSA_v10005291mg [Eutrema salsugineum] Length = 514 Score = 55.5 bits (132), Expect(2) = 3e-09 Identities = 23/50 (46%), Positives = 36/50 (72%) Frame = +2 Query: 245 RKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEMGRTG 394 ++GL A +FDQMP RD++SWN+ML G ++ D E++V +F+ M R+G Sbjct: 68 QRGLMLEAHQVFDQMPVRDMVSWNTMLMGLKKTRDPESVVSFFIAMRRSG 117 Score = 31.2 bits (69), Expect(2) = 3e-09 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 2/76 (2%) Frame = +1 Query: 28 VRGCELSRNAVCSN--QRYFFNELAHQHLLAFDHYFSKSLAQSSHSQRLNEKLFDQNPEL 201 +R E S +C + +R F A + L DH L ++ KLFD+N Sbjct: 1 MRTLETSATFLCGHFSRRIFTIPKATLNRLINDHLREDGLVEA-------RKLFDRNRTS 53 Query: 202 GDVTTWNIMIIGYCKK 249 D +TWN+MI Y ++ Sbjct: 54 LDNSTWNMMITAYVQR 69 >ref|XP_004239364.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62260, mitochondrial-like [Solanum lycopersicum] Length = 661 Score = 46.2 bits (108), Expect(2) = 3e-08 Identities = 20/49 (40%), Positives = 32/49 (65%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEM 382 G A+ G A +F+ MP ++V+SWN+++SGF R+ D++ V YF M Sbjct: 151 GYAKCGRMDEALEVFECMPVKNVVSWNAVISGFLRNGDVKTAVEYFKRM 199 Score = 37.4 bits (85), Expect(2) = 3e-08 Identities = 23/70 (32%), Positives = 36/70 (51%) Frame = +1 Query: 43 LSRNAVCSNQRYFFNELAHQHLLAFDHYFSKSLAQSSHSQRLNEKLFDQNPELGDVTTWN 222 L RN + R F+EL H++ + ++ S + Q + LFD+ P+ DV +WN Sbjct: 56 LIRNGRLEDARVLFDELTHRNTVTWNSMISGYVQQREIVKA--RYLFDEMPQR-DVVSWN 112 Query: 223 IMIIGYCKKR 252 +MI GY R Sbjct: 113 LMISGYLSCR 122 >emb|CAN67319.1| hypothetical protein VITISV_039344 [Vitis vinifera] Length = 761 Score = 49.7 bits (117), Expect(2) = 4e-08 Identities = 20/49 (40%), Positives = 31/49 (63%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEM 382 G R G A LFD M R+V+SWN+M++GF ++ D+E + +F+ M Sbjct: 171 GYTRSGRMDEALQLFDSMQERNVVSWNAMVTGFLQNGDVERAIEFFMRM 219 Score = 33.1 bits (74), Expect(2) = 4e-08 Identities = 19/70 (27%), Positives = 37/70 (52%) Frame = +1 Query: 43 LSRNAVCSNQRYFFNELAHQHLLAFDHYFSKSLAQSSHSQRLNEKLFDQNPELGDVTTWN 222 L RN + R F+ + ++++ ++ + + + ++ KLFD+ P+ DV +WN Sbjct: 77 LIRNGRINEARALFDAMPQRNIVTWNSMITGYVRRREMAKA--RKLFDEMPDR-DVVSWN 133 Query: 223 IMIIGYCKKR 252 +MI GY R Sbjct: 134 LMISGYVSCR 143 Score = 46.6 bits (109), Expect(2) = 2e-06 Identities = 18/41 (43%), Positives = 28/41 (68%) Frame = +2 Query: 260 QHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEM 382 + +HLFD+MP RD +SWN+M+SG+ RS ++ + F M Sbjct: 148 EEGRHLFDEMPERDCVSWNTMISGYTRSGRMDEALQLFDSM 188 Score = 30.8 bits (68), Expect(2) = 2e-06 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +1 Query: 130 SKSLAQSSHSQRLNEK--LFDQNPELGDVTTWNIMIIGYCKKR 252 +K ++ + R+NE LFD P+ ++ TWN MI GY ++R Sbjct: 71 NKRISHLIRNGRINEARALFDAMPQR-NIVTWNSMITGYVRRR 112 >ref|XP_004292461.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62260, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 942 Score = 45.1 bits (105), Expect(2) = 6e-08 Identities = 20/49 (40%), Positives = 31/49 (63%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEM 382 G A+ G A LF+ MP R V+SWN+M++GF ++ D+ + V +F M Sbjct: 432 GYAKNGRMGEALRLFECMPERTVVSWNAMVTGFLQNGDVGSAVEFFERM 480 Score = 37.4 bits (85), Expect(2) = 6e-08 Identities = 22/70 (31%), Positives = 37/70 (52%) Frame = +1 Query: 43 LSRNAVCSNQRYFFNELAHQHLLAFDHYFSKSLAQSSHSQRLNEKLFDQNPELGDVTTWN 222 L R S R F+ + H++++ ++ S + + ++ KLFD+ PE DV +WN Sbjct: 337 LIRTGRISQAREVFDNMKHRNIVTWNSMISGYVKRREIAKA--RKLFDEMPER-DVVSWN 393 Query: 223 IMIIGYCKKR 252 +MI GY R Sbjct: 394 VMISGYVSCR 403 >ref|NP_197403.2| mitochondrial editing factor 18 [Arabidopsis thaliana] gi|223635651|sp|P0C8Q8.1|PP394_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g19020, mitochondrial; Flags: Precursor gi|332005257|gb|AED92640.1| mitochondrial editing factor 18 [Arabidopsis thaliana] Length = 685 Score = 52.0 bits (123), Expect(2) = 6e-08 Identities = 21/53 (39%), Positives = 34/53 (64%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEMGRTG 394 G ++ GL + A+ LFDQ+ +D++SW +M+ G R N L+ + Y+ EM R G Sbjct: 248 GYSKAGLIEQAEELFDQITEKDIVSWGTMIDGCLRKNQLDEALVYYTEMLRCG 300 Score = 30.4 bits (67), Expect(2) = 6e-08 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +1 Query: 175 KLFDQNPELGDVTTWNIMIIGYCK 246 KLFD+ PE ++ TWN+M+ GY K Sbjct: 229 KLFDEMPER-NLVTWNVMLNGYSK 251 >ref|XP_002278375.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62260, mitochondrial [Vitis vinifera] Length = 681 Score = 49.7 bits (117), Expect(2) = 6e-08 Identities = 20/49 (40%), Positives = 31/49 (63%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEM 382 G R G A LFD M R+V+SWN+M++GF ++ D+E + +F+ M Sbjct: 171 GYTRSGRMDEALQLFDSMQERNVVSWNAMVTGFLQNGDVERAIEFFMRM 219 Score = 32.7 bits (73), Expect(2) = 6e-08 Identities = 18/66 (27%), Positives = 36/66 (54%) Frame = +1 Query: 43 LSRNAVCSNQRYFFNELAHQHLLAFDHYFSKSLAQSSHSQRLNEKLFDQNPELGDVTTWN 222 L RN + R F+ + ++++ ++ + + + ++ KLFD+ P+ DV +WN Sbjct: 77 LIRNGRINEARALFDAMPQRNIVTWNSMITGYVRRREMAKA--RKLFDEMPDR-DVVSWN 133 Query: 223 IMIIGY 240 +MI GY Sbjct: 134 LMISGY 139 Score = 46.6 bits (109), Expect(2) = 2e-06 Identities = 18/41 (43%), Positives = 28/41 (68%) Frame = +2 Query: 260 QHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEM 382 + +HLFD+MP RD +SWN+M+SG+ RS ++ + F M Sbjct: 148 EEGRHLFDEMPERDCVSWNTMISGYTRSGRMDEALQLFDSM 188 Score = 30.8 bits (68), Expect(2) = 2e-06 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +1 Query: 130 SKSLAQSSHSQRLNEK--LFDQNPELGDVTTWNIMIIGYCKKR 252 +K ++ + R+NE LFD P+ ++ TWN MI GY ++R Sbjct: 71 NKRISHLIRNGRINEARALFDAMPQR-NIVTWNSMITGYVRRR 112 >tpg|DAA61013.1| TPA: hypothetical protein ZEAMMB73_343744 [Zea mays] Length = 557 Score = 48.9 bits (115), Expect(2) = 6e-08 Identities = 21/40 (52%), Positives = 30/40 (75%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLE 355 G A++G + A+ LFD MP RDV+SWNSML G+ ++ D+E Sbjct: 223 GYAQRGDMESAKRLFDVMPVRDVVSWNSMLDGYAQTGDIE 262 Score = 33.5 bits (75), Expect(2) = 6e-08 Identities = 19/59 (32%), Positives = 31/59 (52%) Frame = +1 Query: 73 RYFFNELAHQHLLAFDHYFSKSLAQSSHSQRLNEKLFDQNPELGDVTTWNIMIIGYCKK 249 R F+E+ + L+ ++ S A+ + +LFD PE DV TWN M+ GY ++ Sbjct: 172 RRLFDEMPERDLVTYNSMLSGYAAEGDIANA--RELFDGMPER-DVVTWNSMLAGYAQR 227 >ref|XP_002873924.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319761|gb|EFH50183.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 939 Score = 51.6 bits (122), Expect(2) = 7e-08 Identities = 21/53 (39%), Positives = 34/53 (64%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEMGRTG 394 G ++ GL + A+ LFDQ+ +D++SW +M+ G R N L+ + Y+ EM R G Sbjct: 502 GYSKAGLIEQAKELFDQITEKDIVSWGTMIDGCLRKNQLDEALVYYTEMLRRG 554 Score = 30.4 bits (67), Expect(2) = 7e-08 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +1 Query: 175 KLFDQNPELGDVTTWNIMIIGYCK 246 KLFD+ PE ++ TWN+M+ GY K Sbjct: 483 KLFDEMPER-NLVTWNVMLNGYSK 505 >ref|XP_002278668.2| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Vitis vinifera] Length = 877 Score = 57.4 bits (137), Expect(2) = 7e-08 Identities = 26/53 (49%), Positives = 35/53 (66%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEMGRTG 394 G A +G AQ LFD MP RDV+SWNS++SG+ + D ++ FL+MGR G Sbjct: 117 GYAGRGDIGVAQKLFDAMPERDVVSWNSLISGYLHNGDHRKVIDVFLQMGRMG 169 Score = 24.6 bits (52), Expect(2) = 7e-08 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 175 KLFDQNPELGDVTTWNIMIIGY 240 K+FD P+ D +WN M+ GY Sbjct: 98 KVFDGMPQR-DTVSWNAMLFGY 118 >emb|CBI16904.3| unnamed protein product [Vitis vinifera] Length = 843 Score = 57.4 bits (137), Expect(2) = 7e-08 Identities = 26/53 (49%), Positives = 35/53 (66%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEMGRTG 394 G A +G AQ LFD MP RDV+SWNS++SG+ + D ++ FL+MGR G Sbjct: 117 GYAGRGDIGVAQKLFDAMPERDVVSWNSLISGYLHNGDHRKVIDVFLQMGRMG 169 Score = 24.6 bits (52), Expect(2) = 7e-08 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 175 KLFDQNPELGDVTTWNIMIIGY 240 K+FD P+ D +WN M+ GY Sbjct: 98 KVFDGMPQR-DTVSWNAMLFGY 118 >ref|XP_007216989.1| hypothetical protein PRUPE_ppa002640mg [Prunus persica] gi|462413139|gb|EMJ18188.1| hypothetical protein PRUPE_ppa002640mg [Prunus persica] Length = 649 Score = 44.7 bits (104), Expect(2) = 7e-08 Identities = 19/49 (38%), Positives = 33/49 (67%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEM 382 G A+KG A+ FD+MP ++++SWNS+L+G+ ++ + V +F EM Sbjct: 72 GYAKKGKFDDAKRFFDEMPAKNLVSWNSILAGYTKNGKMRLGVKFFDEM 120 Score = 37.4 bits (85), Expect(2) = 7e-08 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 2/70 (2%) Frame = +1 Query: 46 SRNAVCSNQRYFFNELAHQHLLAFDHYFSKSLAQSSHSQRLNE--KLFDQNPELGDVTTW 219 ++N SN R+ F+++ H++L++++ + L H+ R+ E +LF D W Sbjct: 17 AKNGRVSNARHLFDQMPHRNLVSWNSMIAGYL----HNDRVEEAYRLFR------DAVCW 66 Query: 220 NIMIIGYCKK 249 N MI GY KK Sbjct: 67 NAMIAGYAKK 76 >ref|XP_004503293.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cicer arietinum] Length = 763 Score = 41.2 bits (95), Expect(2) = 1e-07 Identities = 22/68 (32%), Positives = 37/68 (54%) Frame = +1 Query: 49 RNAVCSNQRYFFNELAHQHLLAFDHYFSKSLAQSSHSQRLNEKLFDQNPELGDVTTWNIM 228 RN C + + FN + + ++++ S L S + L +LFDQ PE D+ +WN+M Sbjct: 58 RNGHCDSALHVFNNMPRRSSVSYNAMISGYLRNSKFN--LARELFDQMPER-DLFSWNVM 114 Query: 229 IIGYCKKR 252 + GY + R Sbjct: 115 LTGYVRNR 122 Score = 40.4 bits (93), Expect(2) = 1e-07 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGF 334 G R A+ LFD MP RDV+SWN+MLSG+ Sbjct: 117 GYVRNRRLGDARRLFDLMPDRDVVSWNAMLSGY 149 >gb|EMT29065.1| hypothetical protein F775_00619 [Aegilops tauschii] Length = 606 Score = 47.0 bits (110), Expect(2) = 2e-07 Identities = 22/51 (43%), Positives = 31/51 (60%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEMGR 388 G R G + A+ +FD MP RDV+SWNSML G+ ++ D++ F M R Sbjct: 220 GYTRLGDMEEARRMFDAMPERDVVSWNSMLDGYAQAGDVKMARAMFDGMPR 270 Score = 33.9 bits (76), Expect(2) = 2e-07 Identities = 19/66 (28%), Positives = 36/66 (54%) Frame = +1 Query: 49 RNAVCSNQRYFFNELAHQHLLAFDHYFSKSLAQSSHSQRLNEKLFDQNPELGDVTTWNIM 228 R+ + + R F+++ + L++++ S A + ++LFDQ PE DV +WN M Sbjct: 161 RSGLLPSARQLFDQMPQRDLVSYNSMLSGHAAAGDMAGA--QQLFDQMPER-DVVSWNSM 217 Query: 229 IIGYCK 246 + GY + Sbjct: 218 LGGYTR 223 >ref|XP_006357212.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62260, mitochondrial-like [Solanum tuberosum] Length = 668 Score = 45.4 bits (106), Expect(2) = 2e-07 Identities = 20/49 (40%), Positives = 32/49 (65%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYFLEM 382 G A+ G A +F+ MP ++V+SWN+++SGF R+ D++ V YF M Sbjct: 158 GYAKCGRMGEALEVFECMPVKNVVSWNAVISGFLRNGDVKTAVEYFKRM 206 Score = 35.0 bits (79), Expect(2) = 2e-07 Identities = 22/70 (31%), Positives = 36/70 (51%) Frame = +1 Query: 43 LSRNAVCSNQRYFFNELAHQHLLAFDHYFSKSLAQSSHSQRLNEKLFDQNPELGDVTTWN 222 L RN + R F++L H++ + ++ S + Q + LFD+ P+ DV +WN Sbjct: 63 LIRNGRLEDARELFDKLIHRNTVTWNSMISGYVQQREIVKA--RYLFDEMPQR-DVVSWN 119 Query: 223 IMIIGYCKKR 252 +MI GY R Sbjct: 120 LMISGYLSCR 129 >ref|XP_004144924.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62260, mitochondrial-like [Cucumis sativus] Length = 664 Score = 48.5 bits (114), Expect(2) = 2e-07 Identities = 18/46 (39%), Positives = 32/46 (69%) Frame = +2 Query: 236 GTARKGLTQHAQHLFDQMPHRDVISWNSMLSGFYRSNDLENLVGYF 373 G A+ G+ A+ LF++MP R+V+SWN+M+SG+ + +E + +F Sbjct: 161 GYAKSGMMDKAEELFNEMPERNVVSWNAMVSGYLMNGHVEKAIEFF 206 Score = 32.0 bits (71), Expect(2) = 2e-07 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +1 Query: 73 RYFFNELAHQHLLAFDHYFSKSLAQSSHSQRLNEKLFDQNPELGDVTTWNIMIIGYCK 246 R F E+ ++ +++++ S ++ +FDQ PE D +WN M+ GY K Sbjct: 108 RQLFEEMPNRDIVSWNLMLSGYISCGGKFVERARNMFDQMPET-DCVSWNTMLSGYAK 164