BLASTX nr result
ID: Cocculus23_contig00030306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00030306 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulga... 57 3e-06 >emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1369 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/50 (54%), Positives = 36/50 (72%) Frame = -3 Query: 150 DRNTKFLGCLNGNDSLADLNVTYIVMIPKIKDPQTPIDFRPISLYNVVYK 1 D TK L LN D++ +N T+IV+IPK K ++P+DFRPISL NV+YK Sbjct: 475 DVTTKVLNMLNNVDNIGAVNQTHIVLIPKKKHCESPVDFRPISLCNVLYK 524