BLASTX nr result
ID: Cocculus23_contig00030045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00030045 (657 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19389.3| unnamed protein product [Vitis vinifera] 66 8e-09 ref|XP_002283378.1| PREDICTED: pentatricopeptide repeat-containi... 66 8e-09 ref|XP_002301807.2| hypothetical protein POPTR_0002s24950g [Popu... 60 5e-07 ref|XP_006484804.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_007147943.1| hypothetical protein PHAVU_006G167600g [Phas... 59 1e-06 ref|XP_006437247.1| hypothetical protein CICLE_v10031787mg [Citr... 59 1e-06 ref|XP_007199919.1| hypothetical protein PRUPE_ppa006910mg [Prun... 57 5e-06 >emb|CBI19389.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -2 Query: 656 REGRGDDAFELLEELRKKDGSMGDKTYKTLLDGLHFLSQE 537 REG+ +DAFELLE+LRKKD MG+KTYKTL+ GLHFLSQE Sbjct: 326 REGKCNDAFELLEDLRKKDAWMGEKTYKTLVKGLHFLSQE 365 >ref|XP_002283378.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Vitis vinifera] Length = 393 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -2 Query: 656 REGRGDDAFELLEELRKKDGSMGDKTYKTLLDGLHFLSQE 537 REG+ +DAFELLE+LRKKD MG+KTYKTL+ GLHFLSQE Sbjct: 354 REGKCNDAFELLEDLRKKDAWMGEKTYKTLVKGLHFLSQE 393 >ref|XP_002301807.2| hypothetical protein POPTR_0002s24950g [Populus trichocarpa] gi|550345772|gb|EEE81080.2| hypothetical protein POPTR_0002s24950g [Populus trichocarpa] Length = 387 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 656 REGRGDDAFELLEELRKKDGSMGDKTYKTLLDGLHFLSQE 537 REG D AFELLEE RKKDG MG+K YK+LL+GLHF+S++ Sbjct: 348 REGMVDKAFELLEEWRKKDGFMGEKNYKSLLNGLHFVSRQ 387 >ref|XP_006484804.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Citrus sinensis] Length = 388 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -2 Query: 656 REGRGDDAFELLEELRKKDGSMGDKTYKTLLDGLHFLSQE 537 REGR +AF+LLEE RK+D MGD+ YKTLL+GLHF +QE Sbjct: 349 REGRESEAFDLLEEFRKRDVVMGDRNYKTLLNGLHFQNQE 388 >ref|XP_007147943.1| hypothetical protein PHAVU_006G167600g [Phaseolus vulgaris] gi|561021166|gb|ESW19937.1| hypothetical protein PHAVU_006G167600g [Phaseolus vulgaris] Length = 373 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -2 Query: 656 REGRGDDAFELLEELRKKDGSMGDKTYKTLLDGLHFLSQE 537 REGR DDAFELL+E +K+D SMG+K YKTLL+ LHF +E Sbjct: 334 REGRVDDAFELLDECKKRDASMGEKMYKTLLEDLHFSCRE 373 >ref|XP_006437247.1| hypothetical protein CICLE_v10031787mg [Citrus clementina] gi|557539443|gb|ESR50487.1| hypothetical protein CICLE_v10031787mg [Citrus clementina] Length = 388 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -2 Query: 656 REGRGDDAFELLEELRKKDGSMGDKTYKTLLDGLHFLSQE 537 REGR +AF+LLEE RK+D MGD+ YKTLL+GLHF +QE Sbjct: 349 REGRESEAFDLLEEFRKRDVVMGDRNYKTLLNGLHFQNQE 388 >ref|XP_007199919.1| hypothetical protein PRUPE_ppa006910mg [Prunus persica] gi|462395319|gb|EMJ01118.1| hypothetical protein PRUPE_ppa006910mg [Prunus persica] Length = 390 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = -2 Query: 656 REGRGDDAFELLEELRKKDGSMGDKTYKTLLDGLHFLSQE 537 R+G+G +AF+LLE+ RK D MG+KTYKTLL+ LHF++ E Sbjct: 351 RDGKGSEAFDLLEDFRKGDSKMGEKTYKTLLNALHFVNGE 390