BLASTX nr result
ID: Cocculus23_contig00029077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00029077 (444 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006352535.1| PREDICTED: mitochondrial import inner membra... 55 8e-06 ref|XP_003633330.1| PREDICTED: mitochondrial import inner membra... 55 8e-06 emb|CAN66866.1| hypothetical protein VITISV_022042 [Vitis vinifera] 55 8e-06 >ref|XP_006352535.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Solanum tuberosum] Length = 359 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 386 VIRHRPADIRTVLASYQGCDIATEFIECSKDRQR 285 V +HRPADIR VLASYQGCDI EF+E SK+ QR Sbjct: 312 VAKHRPADIRAVLASYQGCDIPKEFVERSKEHQR 345 >ref|XP_003633330.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Vitis vinifera] gi|296085020|emb|CBI28435.3| unnamed protein product [Vitis vinifera] Length = 362 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -2 Query: 386 VIRHRPADIRTVLASYQGCDIATEFIECSKDRQR 285 V RHRPADIR VLASYQG DIATEFI SKD QR Sbjct: 315 VARHRPADIRPVLASYQGRDIATEFIARSKDHQR 348 >emb|CAN66866.1| hypothetical protein VITISV_022042 [Vitis vinifera] Length = 104 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -2 Query: 386 VIRHRPADIRTVLASYQGCDIATEFIECSKDRQR 285 V RHRPADIR VLASYQG DIATEFI SKD QR Sbjct: 57 VARHRPADIRPVLASYQGRDIATEFIARSKDHQR 90