BLASTX nr result
ID: Cocculus23_contig00028380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00028380 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] 62 8e-08 ref|XP_006372009.1| hypothetical protein POPTR_0018s07320g [Popu... 60 4e-07 >emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] Length = 1382 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/50 (52%), Positives = 37/50 (74%) Frame = -1 Query: 152 MSTVWDDLLQAISMKLN*NNYTYWAYVLERFLIGKKMWGYVYGVVPMPSD 3 M+T DD LQ++S++L+ NY+YW+YV+ FL GKKMWGYV G +P + Sbjct: 1 MATERDDSLQSVSVRLDGKNYSYWSYVMRNFLKGKKMWGYVSGTYVVPKN 50 >ref|XP_006372009.1| hypothetical protein POPTR_0018s07320g [Populus trichocarpa] gi|550318265|gb|ERP49806.1| hypothetical protein POPTR_0018s07320g [Populus trichocarpa] Length = 280 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = -1 Query: 152 MSTVWDDLLQAISMKLN*NNYTYWAYVLERFLIGKKMWGYVYGVVPMPSD 3 M+T DD LQ +S++L+ NY YW+YV+ F+ GKKMWGYV G +P + Sbjct: 1 MATEKDDSLQLVSVRLDGKNYLYWSYVIRNFIKGKKMWGYVSGTYVIPKN 50