BLASTX nr result
ID: Cocculus23_contig00028229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00028229 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520178.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 ref|XP_002312691.1| hypothetical protein POPTR_0008s19520g [Popu... 55 8e-06 >ref|XP_002520178.1| conserved hypothetical protein [Ricinus communis] gi|223540670|gb|EEF42233.1| conserved hypothetical protein [Ricinus communis] Length = 254 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 103 LLFRFLQSMFRKVSKRAKKATRSMLPPAFSPQLV 2 LLF+FLQSMF+K+SKRAKKA+RS+LP SPQLV Sbjct: 153 LLFKFLQSMFKKISKRAKKASRSILPSVISPQLV 186 >ref|XP_002312691.1| hypothetical protein POPTR_0008s19520g [Populus trichocarpa] gi|222852511|gb|EEE90058.1| hypothetical protein POPTR_0008s19520g [Populus trichocarpa] Length = 203 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 103 LLFRFLQSMFRKVSKRAKKATRSMLPPAFSPQLV 2 LL RFLQSMF+K+SKRAKKA+RSMLP SPQLV Sbjct: 102 LLIRFLQSMFKKLSKRAKKASRSMLPAVISPQLV 135