BLASTX nr result
ID: Cocculus23_contig00028062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00028062 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003468989.1| PREDICTED: fatty acid-binding protein, liver... 58 2e-06 >ref|XP_003468989.1| PREDICTED: fatty acid-binding protein, liver-like [Cavia porcellus] Length = 127 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/90 (37%), Positives = 52/90 (57%), Gaps = 1/90 (1%) Frame = -1 Query: 269 GKYEFTGDDGKFGDYLTATGLAPEHVEIGKQLKPTLTFKNNGAD-KYGLSINSEVINKDY 93 GKY+ + F ++ A GL + ++ GK K T+ F NG K+ ++ S+VI D Sbjct: 5 GKYQLQSQEN-FEAFMKAVGLPDDLIQKGKDTKGTVEFVQNGKHFKFTITSGSKVIQND- 62 Query: 92 DFTIGQESTEKSPSGKDIKAVYTKSGDNKL 3 FT+G+ES +S +G+ +KAV GDNKL Sbjct: 63 -FTLGEESEMQSITGEKVKAVVNMEGDNKL 91