BLASTX nr result
ID: Cocculus23_contig00027649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00027649 (994 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB74570.1| hypothetical protein L484_026267 [Morus notabilis] 65 3e-11 gb|AGC78985.1| hypothetical protein (mitochondrion) [Vicia faba] 73 2e-10 ref|XP_004510058.1| PREDICTED: uncharacterized protein LOC101507... 56 6e-09 ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medica... 56 7e-09 >gb|EXB74570.1| hypothetical protein L484_026267 [Morus notabilis] Length = 169 Score = 64.7 bits (156), Expect(2) = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 903 PTPGRVSEPCNRRPFRAVRGALESAAGARL 992 PTPGRVSEPCNRRPFRAVRGALESAAGARL Sbjct: 124 PTPGRVSEPCNRRPFRAVRGALESAAGARL 153 Score = 31.2 bits (69), Expect(2) = 3e-11 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 848 HAANRGPACAGPPTNNRYSHP 910 H A CAGPPTNNRY P Sbjct: 106 HMACMYSGCAGPPTNNRYPTP 126 >gb|AGC78985.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 198 Score = 73.2 bits (178), Expect = 2e-10 Identities = 40/58 (68%), Positives = 42/58 (72%), Gaps = 2/58 (3%) Frame = -1 Query: 172 LYLDLSPKYGRTLT*RA*PTEG--SPPVPDIVLRRCPLDERGHHSLSFLNRSDQDKWV 5 ++LDLSP Y R T G SPPVPDIVLRRCPL ERGHH LSF NRSDQDKWV Sbjct: 17 IFLDLSP-YLRKNQHLKGVTNGRFSPPVPDIVLRRCPLGERGHHYLSFFNRSDQDKWV 73 >ref|XP_004510058.1| PREDICTED: uncharacterized protein LOC101507236 [Cicer arietinum] Length = 614 Score = 56.2 bits (134), Expect(2) = 6e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 907 PQAELVSRVIGDHFARFGGHLSQPP 981 PQAELVSRVIGDHFARFGGHLSQPP Sbjct: 56 PQAELVSRVIGDHFARFGGHLSQPP 80 Score = 31.6 bits (70), Expect(2) = 6e-09 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 873 APDRRRIIGTPTP 911 APDRRRIIGTPTP Sbjct: 44 APDRRRIIGTPTP 56 >ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477395|gb|AES58598.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 339 Score = 56.2 bits (134), Expect(2) = 7e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 907 PQAELVSRVIGDHFARFGGHLSQPP 981 PQAELVSRVIGDHFARFGGHLSQPP Sbjct: 56 PQAELVSRVIGDHFARFGGHLSQPP 80 Score = 31.6 bits (70), Expect(2) = 7e-09 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 873 APDRRRIIGTPTP 911 APDRRRIIGTPTP Sbjct: 44 APDRRRIIGTPTP 56