BLASTX nr result
ID: Cocculus23_contig00027015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00027015 (276 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC28025.1| Protein ycf2 [Morus notabilis] 65 1e-08 ref|YP_002836134.1| hypothetical chloroplast RF2 [Megaleranthis ... 65 1e-08 ref|YP_001004228.1| hypothetical chloroplast RF2 [Ranunculus mac... 65 1e-08 ref|YP_740694.1| hypothetical chloroplast RF2 [Nandina domestica... 65 1e-08 gb|AEQ36981.1| hypothetical chloroplast RF2 (chloroplast) [Datur... 64 2e-08 ref|YP_009019835.1| Ycf2 (chloroplast) [Vitis rotundifolia] gi|5... 64 3e-08 gb|AHH24317.1| hypothetical chloroplast protein ycf2 (chloroplas... 64 3e-08 gb|AHA13226.1| hypothetical chloroplast RF21 [Thaumatococcus dan... 64 3e-08 gb|AHA12882.1| hypothetical chloroplast RF21 [Maranta leuconeura... 64 3e-08 gb|AHA12799.1| hypothetical chloroplast RF21 [Canna indica] gi|5... 64 3e-08 ref|YP_008854469.1| hypothetical chloroplast RF21 [Musa textilis... 64 3e-08 emb|CCW72420.1| ycf2 (chloroplast) [Musa acuminata subsp. malacc... 64 3e-08 ref|YP_008081309.1| hypothetical chloroplast RF2 (chloroplast) [... 64 3e-08 ref|YP_008081501.1| Ycf2 (chloroplast) [Trochodendron aralioides... 64 3e-08 ref|YP_008081409.1| Ycf2 (chloroplast) [Tetracentron sinense] gi... 64 3e-08 gb|AGJ51293.1| Ycf2 (chloroplast) [Solanum carolinense] 64 3e-08 ref|YP_007890417.1| hypothetical chloroplast RF2 (chloroplast) [... 64 3e-08 gb|AGE93241.1| hypothetical chloroplast RF21 [Calectasia narraga... 64 3e-08 ref|YP_007475680.1| hypothetical chloroplast RF21 [Heliconia col... 64 3e-08 ref|YP_007475663.1| hypothetical chloroplast RF21 [Heliconia col... 64 3e-08 >gb|EXC28025.1| Protein ycf2 [Morus notabilis] Length = 143 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQNLIQIQYSTY 150 SIHPI SDPGCDMVPK E DMD SNKISFLN+N+ ++Y+ + Sbjct: 96 SIHPISSDPGCDMVPKDELDMDSSNKISFLNKNVFHLKYALF 137 >ref|YP_002836134.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|229577815|ref|YP_002836151.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|226933926|gb|ACO92059.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|226933943|gb|ACO92076.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] Length = 2288 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLNQN Sbjct: 558 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNQN 590 >ref|YP_001004228.1| hypothetical chloroplast RF2 [Ranunculus macranthus] gi|122894049|ref|YP_001004245.1| hypothetical chloroplast RF2 [Ranunculus macranthus] gi|205413370|sp|A1XGT0.1|YCF2_RANMC RecName: Full=Protein Ycf2 gi|85540846|gb|ABC70798.1| hypothetical chloroplast RF2 [Ranunculus macranthus] gi|85540863|gb|ABC70815.1| hypothetical chloroplast RF2 [Ranunculus macranthus] Length = 2294 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLNQN Sbjct: 553 SIHPILSDPGCDMVPKDEPDMDSSNKISFLNQN 585 >ref|YP_740694.1| hypothetical chloroplast RF2 [Nandina domestica] gi|114330032|ref|YP_740713.1| hypothetical chloroplast RF2 [Nandina domestica] gi|122165906|sp|Q09FP8.1|YCF2_NANDO RecName: Full=Protein Ycf2 gi|114054515|gb|ABI49908.1| hypothetical chloroplast RF2 [Nandina domestica] gi|114054534|gb|ABI49927.1| hypothetical chloroplast RF2 [Nandina domestica] Length = 2299 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLNQN Sbjct: 561 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNQN 593 >gb|AEQ36981.1| hypothetical chloroplast RF2 (chloroplast) [Datura stramonium] Length = 2267 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQNLI 171 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N I Sbjct: 553 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKNPI 587 >ref|YP_009019835.1| Ycf2 (chloroplast) [Vitis rotundifolia] gi|595789657|ref|YP_009019852.1| Ycf2 (chloroplast) [Vitis rotundifolia] gi|586947457|gb|AHJ91254.1| Ycf2 (chloroplast) [Vitis rotundifolia] gi|586947474|gb|AHJ91271.1| Ycf2 (chloroplast) [Vitis rotundifolia] Length = 2300 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 555 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 587 >gb|AHH24317.1| hypothetical chloroplast protein ycf2 (chloroplast) [Japonolirion osense] Length = 2298 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 555 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 587 >gb|AHA13226.1| hypothetical chloroplast RF21 [Thaumatococcus daniellii] Length = 2277 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 528 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 560 >gb|AHA12882.1| hypothetical chloroplast RF21 [Maranta leuconeura] gi|557637302|gb|AHA12900.1| hypothetical chloroplast RF21 [Maranta leuconeura] Length = 2197 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 528 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 560 >gb|AHA12799.1| hypothetical chloroplast RF21 [Canna indica] gi|557637218|gb|AHA12817.1| hypothetical chloroplast RF21 [Canna indica] Length = 2316 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 553 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 585 >ref|YP_008854469.1| hypothetical chloroplast RF21 [Musa textilis] gi|563940614|ref|YP_008854486.1| hypothetical chloroplast RF21 [Musa textilis] gi|557636956|gb|AHA12558.1| hypothetical chloroplast RF21 [Musa textilis] gi|557636974|gb|AHA12576.1| hypothetical chloroplast RF21 [Musa textilis] Length = 2307 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 549 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 581 >emb|CCW72420.1| ycf2 (chloroplast) [Musa acuminata subsp. malaccensis] gi|525312522|emb|CCW72445.1| ycf2 (chloroplast) [Musa acuminata subsp. malaccensis] Length = 2336 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 569 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 601 >ref|YP_008081309.1| hypothetical chloroplast RF2 (chloroplast) [Catharanthus roseus] gi|511348399|ref|YP_008081328.1| hypothetical chloroplast RF2 (chloroplast) [Catharanthus roseus] gi|474452120|gb|AGI51188.1| hypothetical chloroplast RF2 (chloroplast) [Catharanthus roseus] gi|474452139|gb|AGI51207.1| hypothetical chloroplast RF2 (chloroplast) [Catharanthus roseus] Length = 2273 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 550 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 582 >ref|YP_008081501.1| Ycf2 (chloroplast) [Trochodendron aralioides] gi|511348592|ref|YP_008081518.1| Ycf2 (chloroplast) [Trochodendron aralioides] gi|479279340|gb|AGJ72193.1| Ycf2 (chloroplast) [Trochodendron aralioides] gi|479279357|gb|AGJ72210.1| Ycf2 (chloroplast) [Trochodendron aralioides] Length = 2298 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 558 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 590 >ref|YP_008081409.1| Ycf2 (chloroplast) [Tetracentron sinense] gi|511348499|ref|YP_008081427.1| Ycf2 (chloroplast) [Tetracentron sinense] gi|479279247|gb|AGJ72101.1| Ycf2 (chloroplast) [Tetracentron sinense] gi|479279264|gb|AGJ72118.1| Ycf2 (chloroplast) [Tetracentron sinense] Length = 2292 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 558 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 590 >gb|AGJ51293.1| Ycf2 (chloroplast) [Solanum carolinense] Length = 2076 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 553 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 585 >ref|YP_007890417.1| hypothetical chloroplast RF2 (chloroplast) [Ardisia polysticta] gi|482651262|ref|YP_007890436.1| hypothetical chloroplast RF2 (chloroplast) [Ardisia polysticta] gi|456368014|gb|AGG36928.1| hypothetical chloroplast RF2 (chloroplast) [Ardisia polysticta] gi|456368033|gb|AGG36947.1| hypothetical chloroplast RF2 (chloroplast) [Ardisia polysticta] Length = 2294 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 553 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 585 >gb|AGE93241.1| hypothetical chloroplast RF21 [Calectasia narragara] gi|449326680|gb|AGE93260.1| hypothetical chloroplast RF21 [Calectasia narragara] Length = 2307 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 560 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 592 >ref|YP_007475680.1| hypothetical chloroplast RF21 [Heliconia collinsiana] gi|449326160|gb|AGE92746.1| hypothetical chloroplast RF21 [Heliconia collinsiana] Length = 2296 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 550 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 582 >ref|YP_007475663.1| hypothetical chloroplast RF21 [Heliconia collinsiana] gi|449326141|gb|AGE92727.1| hypothetical chloroplast RF21 [Heliconia collinsiana] Length = 2288 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 275 SIHPI*SDPGCDMVPKYEPDMDCSNKISFLNQN 177 SIHPI SDPGCDMVPK EPDMD SNKISFLN+N Sbjct: 550 SIHPISSDPGCDMVPKDEPDMDSSNKISFLNKN 582