BLASTX nr result
ID: Cocculus23_contig00026667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00026667 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534436.1| conserved hypothetical protein [Ricinus comm... 80 3e-13 ref|XP_002297655.2| hypothetical protein POPTR_0001s04810g, part... 77 2e-12 gb|AFW73695.1| putative DUF231 domain containing family protein,... 77 3e-12 gb|AFW64296.1| putative DUF231 domain containing family protein ... 77 3e-12 ref|XP_003560946.1| PREDICTED: uncharacterized protein LOC100832... 77 3e-12 ref|XP_002454638.1| hypothetical protein SORBIDRAFT_04g034670 [S... 77 3e-12 ref|XP_006649087.1| PREDICTED: protein YLS7-like [Oryza brachyan... 76 4e-12 dbj|BAD16880.1| hypothetical protein [Oryza sativa Japonica Grou... 76 4e-12 gb|AFW85381.1| putative DUF231 domain containing family protein ... 76 4e-12 emb|CBI30004.3| unnamed protein product [Vitis vinifera] 76 4e-12 ref|NP_001173164.1| Os02g0773732 [Oryza sativa Japonica Group] g... 76 4e-12 ref|XP_002436669.1| hypothetical protein SORBIDRAFT_10g006800 [S... 76 4e-12 ref|NP_001141610.1| uncharacterized protein LOC100273728 [Zea ma... 76 4e-12 ref|XP_002280022.1| PREDICTED: uncharacterized protein LOC100255... 76 4e-12 gb|EAY87710.1| hypothetical protein OsI_09124 [Oryza sativa Indi... 76 4e-12 ref|XP_004964924.1| PREDICTED: fibroin heavy chain-like [Setaria... 76 6e-12 ref|XP_004954083.1| PREDICTED: cell wall protein AWA1-like [Seta... 76 6e-12 gb|EMT28814.1| hypothetical protein F775_14799 [Aegilops tauschii] 75 7e-12 ref|XP_004296154.1| PREDICTED: uncharacterized protein LOC101303... 75 7e-12 ref|XP_006849537.1| hypothetical protein AMTR_s00024p00162030 [A... 75 9e-12 >ref|XP_002534436.1| conserved hypothetical protein [Ricinus communis] gi|223525297|gb|EEF27946.1| conserved hypothetical protein [Ricinus communis] Length = 566 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLNGR+MLE+LRGKRLV +GD LNRNMW S LR+ V+DK+KVFE SGR EF+ Sbjct: 268 RLNGRNMLEILRGKRLVFIGDSLNRNMWESMVCILRNAVKDKSKVFEASGREEFK 322 >ref|XP_002297655.2| hypothetical protein POPTR_0001s04810g, partial [Populus trichocarpa] gi|550346525|gb|EEE82460.2| hypothetical protein POPTR_0001s04810g, partial [Populus trichocarpa] Length = 535 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/55 (69%), Positives = 43/55 (78%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 R+NG+ MLE+LRGKRLV VGD LNRNMW S LR+ V DK+KVFE SGR EFR Sbjct: 235 RMNGKIMLEMLRGKRLVFVGDSLNRNMWESLVCILRNSVEDKSKVFEASGREEFR 289 >gb|AFW73695.1| putative DUF231 domain containing family protein, partial [Zea mays] Length = 706 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLN DMLE LRGKRLV VGD LNRNMW S LR+ V+DK+KVFEVSGR +FR Sbjct: 412 RLNPTDMLERLRGKRLVFVGDSLNRNMWESLICILRNSVKDKSKVFEVSGRSQFR 466 >gb|AFW64296.1| putative DUF231 domain containing family protein [Zea mays] Length = 731 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLN DMLE LRGKRLV VGD LNRNMW S LR+ V+DK+KVFEVSGR +FR Sbjct: 435 RLNPTDMLERLRGKRLVFVGDSLNRNMWESLICILRNSVKDKSKVFEVSGRSQFR 489 >ref|XP_003560946.1| PREDICTED: uncharacterized protein LOC100832208 [Brachypodium distachyon] Length = 817 Score = 76.6 bits (187), Expect = 3e-12 Identities = 40/55 (72%), Positives = 41/55 (74%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLN DMLE LRGKRLV VGD LNRNMW S LR VRDK KVFE SGRREF+ Sbjct: 522 RLNPTDMLERLRGKRLVFVGDSLNRNMWESLVCILRHSVRDKRKVFEASGRREFK 576 >ref|XP_002454638.1| hypothetical protein SORBIDRAFT_04g034670 [Sorghum bicolor] gi|241934469|gb|EES07614.1| hypothetical protein SORBIDRAFT_04g034670 [Sorghum bicolor] Length = 733 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLN DMLE LRGKRLV VGD LNRNMW S LR+ V+DK+KVFEVSGR +FR Sbjct: 437 RLNPTDMLERLRGKRLVFVGDSLNRNMWESLICILRNSVKDKSKVFEVSGRSQFR 491 >ref|XP_006649087.1| PREDICTED: protein YLS7-like [Oryza brachyantha] Length = 696 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLN DMLE LRGKRLV VGD LNRNMW S LR+ V+DK+KVFEVSGR+ FR Sbjct: 402 RLNPTDMLERLRGKRLVFVGDSLNRNMWESLVCILRNSVKDKSKVFEVSGRQRFR 456 >dbj|BAD16880.1| hypothetical protein [Oryza sativa Japonica Group] gi|46805768|dbj|BAD17136.1| hypothetical protein [Oryza sativa Japonica Group] gi|125583853|gb|EAZ24784.1| hypothetical protein OsJ_08560 [Oryza sativa Japonica Group] gi|215769281|dbj|BAH01510.1| unnamed protein product [Oryza sativa Japonica Group] Length = 700 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLN DMLE LRGKRLV VGD LNRNMW S LR+ V+DK KVFEVSGR++FR Sbjct: 405 RLNPSDMLERLRGKRLVFVGDSLNRNMWESLVCILRNSVKDKRKVFEVSGRQQFR 459 >gb|AFW85381.1| putative DUF231 domain containing family protein [Zea mays] Length = 865 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/55 (70%), Positives = 42/55 (76%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLN DMLE LRGKRLV VGD LNRNMW S LR+ V+DK KVFE SGRREF+ Sbjct: 570 RLNPTDMLERLRGKRLVFVGDSLNRNMWESLVCILRNSVKDKRKVFEASGRREFK 624 >emb|CBI30004.3| unnamed protein product [Vitis vinifera] Length = 310 Score = 76.3 bits (186), Expect = 4e-12 Identities = 38/55 (69%), Positives = 42/55 (76%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLNG MLELLRGKRLV VGD LNRNMW S LR+ V+D+TKV+E SGR FR Sbjct: 14 RLNGSHMLELLRGKRLVFVGDSLNRNMWESLVCILRNSVKDRTKVYEASGRHHFR 68 >ref|NP_001173164.1| Os02g0773732 [Oryza sativa Japonica Group] gi|255671282|dbj|BAH91893.1| Os02g0773732 [Oryza sativa Japonica Group] Length = 303 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLN DMLE LRGKRLV VGD LNRNMW S LR+ V+DK KVFEVSGR++FR Sbjct: 182 RLNPSDMLERLRGKRLVFVGDSLNRNMWESLVCILRNSVKDKRKVFEVSGRQQFR 236 >ref|XP_002436669.1| hypothetical protein SORBIDRAFT_10g006800 [Sorghum bicolor] gi|241914892|gb|EER88036.1| hypothetical protein SORBIDRAFT_10g006800 [Sorghum bicolor] Length = 869 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/55 (70%), Positives = 42/55 (76%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLN DMLE LRGKRLV VGD LNRNMW S LR+ V+DK KVFE SGRREF+ Sbjct: 574 RLNPTDMLERLRGKRLVFVGDSLNRNMWESLVCILRNSVKDKRKVFEASGRREFK 628 >ref|NP_001141610.1| uncharacterized protein LOC100273728 [Zea mays] gi|194705262|gb|ACF86715.1| unknown [Zea mays] Length = 353 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/55 (70%), Positives = 42/55 (76%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLN DMLE LRGKRLV VGD LNRNMW S LR+ V+DK KVFE SGRREF+ Sbjct: 58 RLNPTDMLERLRGKRLVFVGDSLNRNMWESLVCILRNSVKDKRKVFEASGRREFK 112 >ref|XP_002280022.1| PREDICTED: uncharacterized protein LOC100255639 [Vitis vinifera] Length = 659 Score = 76.3 bits (186), Expect = 4e-12 Identities = 38/55 (69%), Positives = 42/55 (76%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLNG MLELLRGKRLV VGD LNRNMW S LR+ V+D+TKV+E SGR FR Sbjct: 352 RLNGSHMLELLRGKRLVFVGDSLNRNMWESLVCILRNSVKDRTKVYEASGRHHFR 406 >gb|EAY87710.1| hypothetical protein OsI_09124 [Oryza sativa Indica Group] Length = 700 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLN DMLE LRGKRLV VGD LNRNMW S LR+ V+DK KVFEVSGR++FR Sbjct: 405 RLNPSDMLERLRGKRLVFVGDSLNRNMWESLVCILRNSVKDKRKVFEVSGRQQFR 459 >ref|XP_004964924.1| PREDICTED: fibroin heavy chain-like [Setaria italica] Length = 907 Score = 75.9 bits (185), Expect = 6e-12 Identities = 38/55 (69%), Positives = 42/55 (76%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLN DMLE LRGKRLV +GD LNRNMW S LR+ V+DK KVFE SGRREF+ Sbjct: 612 RLNPTDMLERLRGKRLVFIGDSLNRNMWESLVCILRNSVKDKRKVFEASGRREFK 666 >ref|XP_004954083.1| PREDICTED: cell wall protein AWA1-like [Setaria italica] Length = 736 Score = 75.9 bits (185), Expect = 6e-12 Identities = 38/55 (69%), Positives = 43/55 (78%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLN DMLE LRGKRLV VGD LNRNMW S LR+ V+DK+KVFEVSGR +F+ Sbjct: 440 RLNPADMLERLRGKRLVFVGDSLNRNMWESLICILRNSVKDKSKVFEVSGRHQFK 494 >gb|EMT28814.1| hypothetical protein F775_14799 [Aegilops tauschii] Length = 705 Score = 75.5 bits (184), Expect = 7e-12 Identities = 39/55 (70%), Positives = 41/55 (74%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLN DMLE LRGKRLV VGD LNRNMW S LR V+DK KVFE SGRREF+ Sbjct: 410 RLNPTDMLERLRGKRLVFVGDSLNRNMWESLVCILRHSVKDKRKVFEASGRREFK 464 >ref|XP_004296154.1| PREDICTED: uncharacterized protein LOC101303316 [Fragaria vesca subsp. vesca] Length = 520 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/55 (69%), Positives = 43/55 (78%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 R+NGR+ML LLRGKRLV VGD LNRNMW S LR+ V DK++VFE SGR EFR Sbjct: 228 RMNGRNMLGLLRGKRLVFVGDSLNRNMWESLVCLLRNSVDDKSRVFEASGRSEFR 282 >ref|XP_006849537.1| hypothetical protein AMTR_s00024p00162030 [Amborella trichopoda] gi|548853112|gb|ERN11118.1| hypothetical protein AMTR_s00024p00162030 [Amborella trichopoda] Length = 718 Score = 75.1 bits (183), Expect = 9e-12 Identities = 37/55 (67%), Positives = 41/55 (74%) Frame = +3 Query: 108 RLNGRDMLELLRGKRLVSVGDYLNRNMWVSSFFTLRDPVRDKTKVFEVSGRREFR 272 RLNG D L LRGKRLV VGD LNRNMW S TLR + DK++V+E SGRREFR Sbjct: 427 RLNGTDFLRRLRGKRLVFVGDSLNRNMWESLVCTLRHTIADKSRVYEASGRREFR 481