BLASTX nr result
ID: Cocculus23_contig00026555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00026555 (504 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528918.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 >ref|XP_002528918.1| conserved hypothetical protein [Ricinus communis] gi|223531620|gb|EEF33447.1| conserved hypothetical protein [Ricinus communis] Length = 725 Score = 58.9 bits (141), Expect = 7e-07 Identities = 43/106 (40%), Positives = 54/106 (50%), Gaps = 21/106 (19%) Frame = -2 Query: 353 YHLQPSQPDSSAAVQ-----------PPGSSAPTEVPPAGNAYYYQ--------GAVEQP 231 YH Q QPD SA PPG S P ++ +G +++Q + P Sbjct: 93 YHQQ--QPDYSATAYLQPVCYQHDSAPPGVSVP-QIADSGGTHHHQLRQQLQPQSSYNPP 149 Query: 230 QASSSGYSVP--SGLNPXXXXXXXALSQLTQFAGTMDAAERAMAGM 99 QAS + VP +G+NP AL QLTQFAGTMDAAERAM G+ Sbjct: 150 QASVNAAVVPPGNGMNPAAAAAIAALEQLTQFAGTMDAAERAMGGL 195