BLASTX nr result
ID: Cocculus23_contig00025987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00025987 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE63194.1| hypothetical protein OsJ_18003 [Oryza sativa Japo... 55 8e-06 >gb|EEE63194.1| hypothetical protein OsJ_18003 [Oryza sativa Japonica Group] Length = 778 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 94 KSFKMVVLAASIISKSGKALVSRQFVDMSRI 2 K+ KMVVLAASIISKSGKALVSRQFVDMSRI Sbjct: 251 KALKMVVLAASIISKSGKALVSRQFVDMSRI 281