BLASTX nr result
ID: Cocculus23_contig00025891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00025891 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007033919.1| Integral membrane HRF1 family protein [Theob... 75 1e-11 gb|AFK45302.1| unknown [Medicago truncatula] 74 2e-11 ref|XP_002268449.2| PREDICTED: protein YIF1B [Vitis vinifera] 74 2e-11 ref|XP_003621615.1| Protein YIF1B-B [Medicago truncatula] gi|355... 74 2e-11 emb|CBI36691.3| unnamed protein product [Vitis vinifera] 74 2e-11 ref|XP_004507253.1| PREDICTED: protein YIF1B-like [Cicer arietinum] 74 2e-11 ref|XP_003552633.1| PREDICTED: protein YIF1B-like isoform X1 [Gl... 74 3e-11 ref|XP_002534138.1| Protein YIF1A, putative [Ricinus communis] g... 74 3e-11 gb|EYU23874.1| hypothetical protein MIMGU_mgv1a011852mg [Mimulus... 73 4e-11 ref|XP_007151456.1| hypothetical protein PHAVU_004G048100g [Phas... 73 4e-11 ref|XP_007139347.1| hypothetical protein PHAVU_008G021900g [Phas... 73 4e-11 ref|XP_007215807.1| hypothetical protein PRUPE_ppa009973mg [Prun... 73 4e-11 ref|XP_004152088.1| PREDICTED: protein YIF1B-A-like [Cucumis sat... 73 4e-11 ref|XP_003555074.1| PREDICTED: protein YIF1B-like [Glycine max] 73 4e-11 ref|NP_001242205.1| uncharacterized protein LOC100799056 [Glycin... 73 4e-11 gb|EXB88918.1| hypothetical protein L484_003614 [Morus notabilis] 73 5e-11 ref|XP_006402683.1| hypothetical protein EUTSA_v10006169mg [Eutr... 72 8e-11 ref|XP_006415396.1| hypothetical protein EUTSA_v10008472mg [Eutr... 72 8e-11 ref|XP_006305529.1| hypothetical protein CARUB_v10010016mg [Caps... 72 8e-11 ref|XP_004309807.1| PREDICTED: protein YIF1B-B-like [Fragaria ve... 72 8e-11 >ref|XP_007033919.1| Integral membrane HRF1 family protein [Theobroma cacao] gi|508712948|gb|EOY04845.1| Integral membrane HRF1 family protein [Theobroma cacao] Length = 269 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSSRHHYLLLF+ALAQFPLF WLG+I Sbjct: 222 LVKTMKRVLFAEVRSYDSSRHHYLLLFIALAQFPLFTWLGNI 263 >gb|AFK45302.1| unknown [Medicago truncatula] Length = 273 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSS+HHYLLLF+ALAQFPLF+WLG+I Sbjct: 226 LVKTMKRVLFAEVRSYDSSKHHYLLLFIALAQFPLFMWLGNI 267 >ref|XP_002268449.2| PREDICTED: protein YIF1B [Vitis vinifera] Length = 348 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSSRHHYLLLF+ALAQ PLFIWLG+I Sbjct: 301 LVKTMKRVLFAEVRSYDSSRHHYLLLFIALAQLPLFIWLGNI 342 >ref|XP_003621615.1| Protein YIF1B-B [Medicago truncatula] gi|355496630|gb|AES77833.1| Protein YIF1B-B [Medicago truncatula] Length = 382 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSS+HHYLLLF+ALAQFPLF+WLG+I Sbjct: 335 LVKTMKRVLFAEVRSYDSSKHHYLLLFIALAQFPLFMWLGNI 376 >emb|CBI36691.3| unnamed protein product [Vitis vinifera] Length = 337 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSSRHHYLLLF+ALAQ PLFIWLG+I Sbjct: 290 LVKTMKRVLFAEVRSYDSSRHHYLLLFIALAQLPLFIWLGNI 331 >ref|XP_004507253.1| PREDICTED: protein YIF1B-like [Cicer arietinum] Length = 270 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSS+HHYLLLF+AL QFPLFIWLG+I Sbjct: 223 LVKTMKRVLFAEVRSYDSSKHHYLLLFIALVQFPLFIWLGNI 264 >ref|XP_003552633.1| PREDICTED: protein YIF1B-like isoform X1 [Glycine max] gi|571549724|ref|XP_006602991.1| PREDICTED: protein YIF1B-like isoform X2 [Glycine max] gi|571549730|ref|XP_006602992.1| PREDICTED: protein YIF1B-like isoform X3 [Glycine max] gi|571549733|ref|XP_006602993.1| PREDICTED: protein YIF1B-like isoform X4 [Glycine max] gi|571549737|ref|XP_006602994.1| PREDICTED: protein YIF1B-like isoform X5 [Glycine max] Length = 273 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSS+HHYLLLF+ALAQFPLF WLG+I Sbjct: 226 LVKTMKRVLFAEVRSYDSSKHHYLLLFIALAQFPLFTWLGNI 267 >ref|XP_002534138.1| Protein YIF1A, putative [Ricinus communis] gi|223525796|gb|EEF28242.1| Protein YIF1A, putative [Ricinus communis] Length = 269 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VR+YDSSRHHYLLLF+ALAQFPLF WLG+I Sbjct: 222 LVKTMKRVLFAEVRTYDSSRHHYLLLFIALAQFPLFTWLGNI 263 >gb|EYU23874.1| hypothetical protein MIMGU_mgv1a011852mg [Mimulus guttatus] Length = 268 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VR+YDSSRHHYLLLF+ALAQFPL IWLG+I Sbjct: 221 LVKTMKRVLFAEVRTYDSSRHHYLLLFIALAQFPLLIWLGNI 262 >ref|XP_007151456.1| hypothetical protein PHAVU_004G048100g [Phaseolus vulgaris] gi|561024765|gb|ESW23450.1| hypothetical protein PHAVU_004G048100g [Phaseolus vulgaris] Length = 269 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSSRHHYLLLF+AL QFPLF WLG+I Sbjct: 222 LVKTMKRVLFAEVRSYDSSRHHYLLLFIALVQFPLFTWLGNI 263 >ref|XP_007139347.1| hypothetical protein PHAVU_008G021900g [Phaseolus vulgaris] gi|593331844|ref|XP_007139348.1| hypothetical protein PHAVU_008G021900g [Phaseolus vulgaris] gi|561012480|gb|ESW11341.1| hypothetical protein PHAVU_008G021900g [Phaseolus vulgaris] gi|561012481|gb|ESW11342.1| hypothetical protein PHAVU_008G021900g [Phaseolus vulgaris] Length = 273 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSS+HHYLLL +ALAQFPLFIWLG+I Sbjct: 226 LVKTMKRVLFAEVRSYDSSKHHYLLLLIALAQFPLFIWLGNI 267 >ref|XP_007215807.1| hypothetical protein PRUPE_ppa009973mg [Prunus persica] gi|462411957|gb|EMJ17006.1| hypothetical protein PRUPE_ppa009973mg [Prunus persica] Length = 269 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSS+HHYLLLF+ALAQFPLF WLG++ Sbjct: 222 LVKTMKRVLFAEVRSYDSSKHHYLLLFIALAQFPLFTWLGNV 263 >ref|XP_004152088.1| PREDICTED: protein YIF1B-A-like [Cucumis sativus] gi|449502274|ref|XP_004161595.1| PREDICTED: protein YIF1B-A-like [Cucumis sativus] Length = 269 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VR+YDSSRHHYLLLF+ALAQFPLF WLG++ Sbjct: 222 LVKTMKRVLFAEVRTYDSSRHHYLLLFIALAQFPLFTWLGNV 263 >ref|XP_003555074.1| PREDICTED: protein YIF1B-like [Glycine max] Length = 269 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSSRHHYLLLF+AL QFPLF WLG+I Sbjct: 222 LVKTMKRVLFAEVRSYDSSRHHYLLLFIALVQFPLFTWLGNI 263 >ref|NP_001242205.1| uncharacterized protein LOC100799056 [Glycine max] gi|255641178|gb|ACU20866.1| unknown [Glycine max] Length = 269 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSSRHHYLLLF+AL QFPLF WLG+I Sbjct: 222 LVKTMKRVLFAEVRSYDSSRHHYLLLFIALVQFPLFTWLGNI 263 >gb|EXB88918.1| hypothetical protein L484_003614 [Morus notabilis] Length = 269 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLG 122 LVKTMKRV +VRSYDSSRHHYLLLF+ALAQFPLF WLG Sbjct: 222 LVKTMKRVLFAEVRSYDSSRHHYLLLFIALAQFPLFTWLG 261 >ref|XP_006402683.1| hypothetical protein EUTSA_v10006169mg [Eutrema salsugineum] gi|557103782|gb|ESQ44136.1| hypothetical protein EUTSA_v10006169mg [Eutrema salsugineum] Length = 269 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV + RSYDSSRHHYLL+F+ALAQFPL IWLG+I Sbjct: 222 LVKTMKRVLFAEARSYDSSRHHYLLIFVALAQFPLLIWLGNI 263 >ref|XP_006415396.1| hypothetical protein EUTSA_v10008472mg [Eutrema salsugineum] gi|557093167|gb|ESQ33749.1| hypothetical protein EUTSA_v10008472mg [Eutrema salsugineum] Length = 269 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSS+HHYLLLF+AL QFPL IWLG+I Sbjct: 222 LVKTMKRVLFAEVRSYDSSKHHYLLLFLALVQFPLLIWLGNI 263 >ref|XP_006305529.1| hypothetical protein CARUB_v10010016mg [Capsella rubella] gi|482574240|gb|EOA38427.1| hypothetical protein CARUB_v10010016mg [Capsella rubella] Length = 269 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSS+HHYLLLF+AL QFPL IWLG+I Sbjct: 222 LVKTMKRVLFAEVRSYDSSKHHYLLLFLALVQFPLLIWLGNI 263 >ref|XP_004309807.1| PREDICTED: protein YIF1B-B-like [Fragaria vesca subsp. vesca] Length = 263 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 3 LVKTMKRVFSPQVRSYDSSRHHYLLLFMALAQFPLFIWLGSI 128 LVKTMKRV +VRSYDSS+HHYLLLF+ALAQFP+F WLG++ Sbjct: 216 LVKTMKRVLFAEVRSYDSSKHHYLLLFIALAQFPVFTWLGNV 257