BLASTX nr result
ID: Cocculus23_contig00025516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00025516 (461 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001903846.1| hypothetical protein [Podospora anserina S m... 55 8e-06 >ref|XP_001903846.1| hypothetical protein [Podospora anserina S mat+] gi|170936963|emb|CAP61622.1| unnamed protein product [Podospora anserina S mat+] Length = 117 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/55 (45%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +2 Query: 182 GTHTADEHVQ-DLRLPCVCPTPNCPPFLNAKAKCECLASADLACYRSTNGGCPSP 343 G H EH + D RL CVC CP FL K+ CEC A+ CY + GCP P Sbjct: 40 GKHNKHEHPKHDFRLACVCEPDRCPTFLQGKSLCECKAAHLEGCYLKSQRGCPKP 94