BLASTX nr result
ID: Cocculus23_contig00023500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00023500 (292 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74695.1| hypothetical protein VITISV_024648 [Vitis vinifera] 60 2e-07 emb|CAN60188.1| hypothetical protein VITISV_002117 [Vitis vinifera] 57 4e-06 >emb|CAN74695.1| hypothetical protein VITISV_024648 [Vitis vinifera] Length = 1424 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/48 (58%), Positives = 39/48 (81%) Frame = +1 Query: 1 LHFVREKLLTQQIVVQHISSQNQIADLFTKALPSSRFLSLGAKLRVES 144 L+FVREK+L +QI + H+ S +Q+AD+FTKA P+SRFL++ AKL ES Sbjct: 1309 LYFVREKVLQKQIQIHHVPSSDQLADVFTKATPNSRFLTIRAKLSPES 1356 >emb|CAN60188.1| hypothetical protein VITISV_002117 [Vitis vinifera] Length = 1079 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = +1 Query: 1 LHFVREKLLTQQIVVQHISSQNQIADLFTKALPSSRFLSLGAKLRVESKPTLML 162 L+FVREK++ + I V+H+ S +Q DLFTKA+PSSRF L +KL+V TL L Sbjct: 1018 LYFVREKVIQKLIDVRHVPSSDQTTDLFTKAIPSSRFSLLRSKLKVLDLSTLSL 1071