BLASTX nr result
ID: Cocculus23_contig00023455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00023455 (760 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006366725.1| PREDICTED: cytochrome c oxidase subunit 2-li... 59 2e-06 >ref|XP_006366725.1| PREDICTED: cytochrome c oxidase subunit 2-like, partial [Solanum tuberosum] Length = 164 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 104 FSKSMGVESFLRGN*QVQFGGRRASTQPYEYSDY 3 F +GVESFLRGN QVQFGGRRAST PYEYSDY Sbjct: 5 FFLRVGVESFLRGNLQVQFGGRRASTLPYEYSDY 38