BLASTX nr result
ID: Cocculus23_contig00023392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00023392 (260 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308090.2| isoamylase family protein [Populus trichocar... 60 3e-07 ref|XP_006381137.1| hypothetical protein POPTR_0006s07010g [Popu... 60 3e-07 ref|XP_007014466.1| Isoamylase 1 isoform 2 [Theobroma cacao] gi|... 60 3e-07 ref|XP_007014465.1| Isoamylase 1 isoform 1 [Theobroma cacao] gi|... 60 3e-07 ref|XP_003532455.2| PREDICTED: isoamylase 1, chloroplastic-like ... 59 7e-07 ref|XP_003630623.1| Isoamylase [Medicago truncatula] gi|35552464... 59 7e-07 ref|XP_007160229.1| hypothetical protein PHAVU_002G303600g [Phas... 59 7e-07 ref|XP_004242868.1| PREDICTED: isoamylase 1, chloroplastic-like ... 59 9e-07 ref|NP_001274937.1| isoamylase isoform 1 [Solanum tuberosum] gi|... 59 9e-07 ref|XP_002265964.2| PREDICTED: isoamylase 1, chloroplastic-like ... 59 9e-07 emb|CBI40669.3| unnamed protein product [Vitis vinifera] 59 9e-07 emb|CAN70034.1| hypothetical protein VITISV_027248 [Vitis vinifera] 59 9e-07 gb|EXC12839.1| Isoamylase 1 [Morus notabilis] 58 1e-06 gb|EPS64233.1| isoamylase isoform 1, partial [Genlisea aurea] 58 1e-06 ref|XP_001759316.1| predicted protein [Physcomitrella patens] gi... 58 1e-06 ref|XP_002324659.2| isoamylase family protein [Populus trichocar... 58 2e-06 ref|XP_006474309.1| PREDICTED: isoamylase 1, chloroplastic-like ... 57 2e-06 ref|XP_006453203.1| hypothetical protein CICLE_v100074892mg, par... 57 2e-06 ref|XP_004503544.1| PREDICTED: isoamylase 1, chloroplastic-like ... 57 2e-06 ref|XP_004503543.1| PREDICTED: isoamylase 1, chloroplastic-like ... 57 2e-06 >ref|XP_002308090.2| isoamylase family protein [Populus trichocarpa] gi|550335674|gb|EEE91613.2| isoamylase family protein [Populus trichocarpa] Length = 876 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F+LDCL RYW TEMHVDGFRFDLASI+TRSS L Sbjct: 451 FILDCL-RYWVTEMHVDGFRFDLASIMTRSSSL 482 >ref|XP_006381137.1| hypothetical protein POPTR_0006s07010g [Populus trichocarpa] gi|550335673|gb|ERP58934.1| hypothetical protein POPTR_0006s07010g [Populus trichocarpa] Length = 845 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F+LDCL RYW TEMHVDGFRFDLASI+TRSS L Sbjct: 451 FILDCL-RYWVTEMHVDGFRFDLASIMTRSSSL 482 >ref|XP_007014466.1| Isoamylase 1 isoform 2 [Theobroma cacao] gi|508784829|gb|EOY32085.1| Isoamylase 1 isoform 2 [Theobroma cacao] Length = 795 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F+LDCL RYW TEMHVDGFRFDLASI+TRSS L Sbjct: 401 FILDCL-RYWVTEMHVDGFRFDLASIMTRSSSL 432 >ref|XP_007014465.1| Isoamylase 1 isoform 1 [Theobroma cacao] gi|508784828|gb|EOY32084.1| Isoamylase 1 isoform 1 [Theobroma cacao] Length = 904 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F+LDCL RYW TEMHVDGFRFDLASI+TRSS L Sbjct: 510 FILDCL-RYWVTEMHVDGFRFDLASIMTRSSSL 541 >ref|XP_003532455.2| PREDICTED: isoamylase 1, chloroplastic-like [Glycine max] Length = 798 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F++DCL RYW TEMHVDGFRFDLASI+TRSS L Sbjct: 404 FIVDCL-RYWVTEMHVDGFRFDLASIMTRSSSL 435 >ref|XP_003630623.1| Isoamylase [Medicago truncatula] gi|355524645|gb|AET05099.1| Isoamylase [Medicago truncatula] Length = 822 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F++DCL RYW TEMHVDGFRFDLASI+TRSS L Sbjct: 395 FIVDCL-RYWVTEMHVDGFRFDLASIMTRSSSL 426 >ref|XP_007160229.1| hypothetical protein PHAVU_002G303600g [Phaseolus vulgaris] gi|139867053|dbj|BAF52941.1| isoamylase-type starch-debranching enzyme 1 [Phaseolus vulgaris] gi|561033644|gb|ESW32223.1| hypothetical protein PHAVU_002G303600g [Phaseolus vulgaris] Length = 791 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F++DCL RYW TEMHVDGFRFDLASI+TRSS L Sbjct: 397 FIVDCL-RYWVTEMHVDGFRFDLASIMTRSSSL 428 >ref|XP_004242868.1| PREDICTED: isoamylase 1, chloroplastic-like [Solanum lycopersicum] Length = 787 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSS 166 F++DCL RYW TEMHVDGFRFDLASILTRSS Sbjct: 393 FIVDCL-RYWVTEMHVDGFRFDLASILTRSS 422 >ref|NP_001274937.1| isoamylase isoform 1 [Solanum tuberosum] gi|27728145|gb|AAN15317.1| isoamylase isoform 1 [Solanum tuberosum] Length = 793 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSS 166 F++DCL RYW TEMHVDGFRFDLASILTRSS Sbjct: 399 FIVDCL-RYWVTEMHVDGFRFDLASILTRSS 428 >ref|XP_002265964.2| PREDICTED: isoamylase 1, chloroplastic-like [Vitis vinifera] Length = 748 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F+LDCL RYW TEMHVDGFRFDLASI+TR S L Sbjct: 353 FILDCL-RYWVTEMHVDGFRFDLASIMTRGSSL 384 >emb|CBI40669.3| unnamed protein product [Vitis vinifera] Length = 809 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F+LDCL RYW TEMHVDGFRFDLASI+TR S L Sbjct: 414 FILDCL-RYWVTEMHVDGFRFDLASIMTRGSSL 445 >emb|CAN70034.1| hypothetical protein VITISV_027248 [Vitis vinifera] Length = 512 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F+LDCL RYW TEMHVDGFRFDLASI+TR S L Sbjct: 117 FILDCL-RYWVTEMHVDGFRFDLASIMTRGSSL 148 >gb|EXC12839.1| Isoamylase 1 [Morus notabilis] Length = 805 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F++DCL RYW TEMHVDGFRFDLASILTR S L Sbjct: 397 FIVDCL-RYWVTEMHVDGFRFDLASILTRGSSL 428 >gb|EPS64233.1| isoamylase isoform 1, partial [Genlisea aurea] Length = 774 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSS 166 F++DCL RYW TEMH+DGFRFDLASILTRSS Sbjct: 383 FIVDCL-RYWVTEMHIDGFRFDLASILTRSS 412 >ref|XP_001759316.1| predicted protein [Physcomitrella patens] gi|162689629|gb|EDQ76000.1| predicted protein [Physcomitrella patens] Length = 828 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F++DCL RYW TEMHVDGFRFDLASI+TR+S L Sbjct: 432 FIIDCL-RYWVTEMHVDGFRFDLASIMTRASSL 463 >ref|XP_002324659.2| isoamylase family protein [Populus trichocarpa] gi|550318648|gb|EEF03224.2| isoamylase family protein [Populus trichocarpa] Length = 794 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F+LDCL RYW EMHVDGFRFDLASI+TRSS L Sbjct: 400 FILDCL-RYWVIEMHVDGFRFDLASIMTRSSSL 431 >ref|XP_006474309.1| PREDICTED: isoamylase 1, chloroplastic-like [Citrus sinensis] Length = 805 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F++DCL RYW TEMHVDGFRFDLASI+TR S L Sbjct: 411 FIVDCL-RYWVTEMHVDGFRFDLASIMTRGSSL 442 >ref|XP_006453203.1| hypothetical protein CICLE_v100074892mg, partial [Citrus clementina] gi|557556429|gb|ESR66443.1| hypothetical protein CICLE_v100074892mg, partial [Citrus clementina] Length = 624 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F++DCL RYW TEMHVDGFRFDLASI+TR S L Sbjct: 411 FIVDCL-RYWVTEMHVDGFRFDLASIMTRGSSL 442 >ref|XP_004503544.1| PREDICTED: isoamylase 1, chloroplastic-like isoform X3 [Cicer arietinum] Length = 664 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F++DCL RYW TEMHVDGFRFDLASI+TR S L Sbjct: 399 FIVDCL-RYWVTEMHVDGFRFDLASIMTRGSSL 430 >ref|XP_004503543.1| PREDICTED: isoamylase 1, chloroplastic-like isoform X2 [Cicer arietinum] Length = 792 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 258 FVLDCLSRYWATEMHVDGFRFDLASILTRSSRL 160 F++DCL RYW TEMHVDGFRFDLASI+TR S L Sbjct: 399 FIVDCL-RYWVTEMHVDGFRFDLASIMTRGSSL 430