BLASTX nr result
ID: Cocculus23_contig00023248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00023248 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME78575.1| hypothetical protein MYCFIDRAFT_86926 [Pseudocerc... 102 6e-20 gb|EMR64628.1| putative alcohol dehydrogenase i protein [Eutypa ... 100 4e-19 ref|XP_003849721.1| hypothetical protein MYCGRDRAFT_101210 [Zymo... 99 8e-19 gb|EMF09199.1| Can a 1 allergen-like protein [Sphaerulina musiva... 98 1e-18 gb|EPE25629.1| GroES-like protein [Glarea lozoyensis ATCC 20868] 97 2e-18 gb|EMC98009.1| hypothetical protein BAUCODRAFT_410661 [Baudoinia... 97 3e-18 ref|XP_003305011.1| hypothetical protein PTT_17745 [Pyrenophora ... 97 3e-18 ref|XP_003049129.1| predicted protein [Nectria haematococca mpVI... 96 4e-18 gb|EUC50616.1| hypothetical protein COCMIDRAFT_81326 [Bipolaris ... 96 5e-18 gb|ESZ90110.1| alcohol dehydrogenase [Sclerotinia borealis F-4157] 96 5e-18 emb|CCD33880.1| hypothetical protein BofuT4_P062780.1 [Botryotin... 96 5e-18 ref|XP_001939279.1| alcohol dehydrogenase 1 [Pyrenophora tritici... 96 5e-18 ref|XP_001554746.1| hypothetical protein BC1G_06394 [Botryotinia... 96 5e-18 gb|EUC27815.1| hypothetical protein COCCADRAFT_30796 [Bipolaris ... 96 7e-18 gb|EME40972.1| hypothetical protein DOTSEDRAFT_74504 [Dothistrom... 96 7e-18 ref|XP_001798984.1| hypothetical protein SNOG_08675 [Phaeosphaer... 96 7e-18 gb|EOA86928.1| hypothetical protein SETTUDRAFT_115534 [Setosphae... 95 1e-17 gb|EXM33423.1| alcohol dehydrogenase [Fusarium oxysporum f. sp. ... 94 2e-17 gb|EXL47300.1| alcohol dehydrogenase [Fusarium oxysporum f. sp. ... 94 2e-17 gb|EXK87424.1| alcohol dehydrogenase [Fusarium oxysporum f. sp. ... 94 2e-17 >gb|EME78575.1| hypothetical protein MYCFIDRAFT_86926 [Pseudocercospora fijiensis CIRAD86] Length = 352 Score = 102 bits (254), Expect = 6e-20 Identities = 49/55 (89%), Positives = 54/55 (98%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNRKD+SEAI+FFR+GLIKAP+KVVGLSELQKVYDLM KGQIAGRYVLDTS+ Sbjct: 298 SYVGNRKDSSEAIDFFRRGLIKAPFKVVGLSELQKVYDLMHKGQIAGRYVLDTSR 352 >gb|EMR64628.1| putative alcohol dehydrogenase i protein [Eutypa lata UCREL1] Length = 359 Score = 99.8 bits (247), Expect = 4e-19 Identities = 47/55 (85%), Positives = 54/55 (98%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNR+DT+EAI+FFR+GLIKAPYKVVGLSELQKVYDLM +G+IAGRYV+DTSK Sbjct: 305 SYVGNRQDTAEAIDFFRRGLIKAPYKVVGLSELQKVYDLMMEGKIAGRYVVDTSK 359 >ref|XP_003849721.1| hypothetical protein MYCGRDRAFT_101210 [Zymoseptoria tritici IPO323] gi|339469598|gb|EGP84697.1| hypothetical protein MYCGRDRAFT_101210 [Zymoseptoria tritici IPO323] Length = 352 Score = 98.6 bits (244), Expect = 8e-19 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNRKD+SEAIEF+R+GLIKAP+K VGLSELQ VYDLMQKG IAGRYV+DTSK Sbjct: 298 SYVGNRKDSSEAIEFYRRGLIKAPFKTVGLSELQSVYDLMQKGAIAGRYVVDTSK 352 >gb|EMF09199.1| Can a 1 allergen-like protein [Sphaerulina musiva SO2202] Length = 353 Score = 98.2 bits (243), Expect = 1e-18 Identities = 46/55 (83%), Positives = 52/55 (94%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNRKD+SEAIEFFR+G+IKAP+K VGLSELQ VYD+M KGQIAGRYV+DTSK Sbjct: 299 SYVGNRKDSSEAIEFFRRGVIKAPFKTVGLSELQSVYDMMHKGQIAGRYVVDTSK 353 >gb|EPE25629.1| GroES-like protein [Glarea lozoyensis ATCC 20868] Length = 352 Score = 97.4 bits (241), Expect = 2e-18 Identities = 46/55 (83%), Positives = 52/55 (94%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNRKD++EAIEFFR+GLIKAPYK GLSELQKVYDLM +G+IAGRYV+DTSK Sbjct: 298 SYVGNRKDSAEAIEFFRRGLIKAPYKTCGLSELQKVYDLMHEGKIAGRYVVDTSK 352 >gb|EMC98009.1| hypothetical protein BAUCODRAFT_410661 [Baudoinia compniacensis UAMH 10762] Length = 353 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/54 (83%), Positives = 53/54 (98%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTS 74 SYVGNRKD++EAIEF+R+G+IKAPYKVVGLS+LQ+VYDLM KGQIAGRYV+DTS Sbjct: 299 SYVGNRKDSAEAIEFYRRGVIKAPYKVVGLSKLQEVYDLMHKGQIAGRYVVDTS 352 >ref|XP_003305011.1| hypothetical protein PTT_17745 [Pyrenophora teres f. teres 0-1] gi|311318201|gb|EFQ86948.1| hypothetical protein PTT_17745 [Pyrenophora teres f. teres 0-1] Length = 352 Score = 96.7 bits (239), Expect = 3e-18 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNRKD+SEAIEFFR+GLIKAPYKVVGLSELQ VYD M++G I GRYVLDTSK Sbjct: 298 SYVGNRKDSSEAIEFFRRGLIKAPYKVVGLSELQMVYDKMREGAIVGRYVLDTSK 352 >ref|XP_003049129.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256730064|gb|EEU43416.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 286 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/55 (83%), Positives = 52/55 (94%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNR+DT+EAIEFFR+G IKAP+KVVGLSELQ VYDLMQKG IAGRYV+DTS+ Sbjct: 232 SYVGNRQDTAEAIEFFRQGFIKAPFKVVGLSELQDVYDLMQKGGIAGRYVVDTSR 286 >gb|EUC50616.1| hypothetical protein COCMIDRAFT_81326 [Bipolaris oryzae ATCC 44560] Length = 352 Score = 95.9 bits (237), Expect = 5e-18 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNRKD+SEAIEFFR+GLIKAPYKVVGLSELQ VYD M +G + GRYVLDTSK Sbjct: 298 SYVGNRKDSSEAIEFFRRGLIKAPYKVVGLSELQMVYDKMHQGAVVGRYVLDTSK 352 >gb|ESZ90110.1| alcohol dehydrogenase [Sclerotinia borealis F-4157] Length = 351 Score = 95.9 bits (237), Expect = 5e-18 Identities = 44/55 (80%), Positives = 54/55 (98%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNR+D++EAIEF+R+GLIK+P+K VGLSELQKVYDLMQ+G+IAGRYV+DTSK Sbjct: 297 SYVGNRQDSAEAIEFYRRGLIKSPFKTVGLSELQKVYDLMQEGKIAGRYVVDTSK 351 >emb|CCD33880.1| hypothetical protein BofuT4_P062780.1 [Botryotinia fuckeliana T4] Length = 157 Score = 95.9 bits (237), Expect = 5e-18 Identities = 45/55 (81%), Positives = 52/55 (94%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNR+D++EAIEFFR+GLIKAPYK GLSELQKVYDLM +G+IAGRYV+DTSK Sbjct: 103 SYVGNRQDSAEAIEFFRRGLIKAPYKTCGLSELQKVYDLMHEGKIAGRYVVDTSK 157 >ref|XP_001939279.1| alcohol dehydrogenase 1 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187975372|gb|EDU41998.1| alcohol dehydrogenase 1 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 384 Score = 95.9 bits (237), Expect = 5e-18 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNRKD+SEAIEFFR+GLIKAPYK+VGLSELQ VYD M +G I GRYVLDTSK Sbjct: 330 SYVGNRKDSSEAIEFFRRGLIKAPYKIVGLSELQMVYDKMHQGAIVGRYVLDTSK 384 >ref|XP_001554746.1| hypothetical protein BC1G_06394 [Botryotinia fuckeliana B05.10] gi|472235595|gb|EMR80567.1| putative alcohol dehydrogenase protein [Botryotinia fuckeliana BcDW1] Length = 351 Score = 95.9 bits (237), Expect = 5e-18 Identities = 45/55 (81%), Positives = 52/55 (94%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNR+D++EAIEFFR+GLIKAPYK GLSELQKVYDLM +G+IAGRYV+DTSK Sbjct: 297 SYVGNRQDSAEAIEFFRRGLIKAPYKTCGLSELQKVYDLMHEGKIAGRYVVDTSK 351 >gb|EUC27815.1| hypothetical protein COCCADRAFT_30796 [Bipolaris zeicola 26-R-13] gi|578493172|gb|EUN30566.1| hypothetical protein COCVIDRAFT_89948 [Bipolaris victoriae FI3] Length = 352 Score = 95.5 bits (236), Expect = 7e-18 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNRKD+SEAIEFFR+GLIKAPYK+VGLSELQ VYD M +G + GRYVLDTSK Sbjct: 298 SYVGNRKDSSEAIEFFRRGLIKAPYKIVGLSELQMVYDKMHQGAVVGRYVLDTSK 352 >gb|EME40972.1| hypothetical protein DOTSEDRAFT_74504 [Dothistroma septosporum NZE10] Length = 353 Score = 95.5 bits (236), Expect = 7e-18 Identities = 44/55 (80%), Positives = 52/55 (94%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNRKD++EA++FFR+GLIKAP+K VGLSELQ VYDLM KGQIAGRYV+DTS+ Sbjct: 299 SYVGNRKDSAEALDFFRRGLIKAPFKTVGLSELQMVYDLMHKGQIAGRYVVDTSR 353 >ref|XP_001798984.1| hypothetical protein SNOG_08675 [Phaeosphaeria nodorum SN15] gi|111062723|gb|EAT83843.1| hypothetical protein SNOG_08675 [Phaeosphaeria nodorum SN15] Length = 352 Score = 95.5 bits (236), Expect = 7e-18 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNRKD+SEAI+FF +GLIKAP+KVVGLSELQ VYD M KG+IAGRYVLDTSK Sbjct: 298 SYVGNRKDSSEAIDFFARGLIKAPFKVVGLSELQMVYDKMHKGEIAGRYVLDTSK 352 >gb|EOA86928.1| hypothetical protein SETTUDRAFT_115534 [Setosphaeria turcica Et28A] Length = 352 Score = 94.7 bits (234), Expect = 1e-17 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNRKD+SEAIEFFR+GLIKAPYKVVGLSELQ VYD M +G + GRYVLDTS+ Sbjct: 298 SYVGNRKDSSEAIEFFRRGLIKAPYKVVGLSELQMVYDKMHQGAVVGRYVLDTSR 352 >gb|EXM33423.1| alcohol dehydrogenase [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 444 Score = 94.4 bits (233), Expect = 2e-17 Identities = 43/55 (78%), Positives = 52/55 (94%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNR+DT+EAIEF+R+GLIKAPYK+VGLSELQKVYD+M G +AGRYV+DTS+ Sbjct: 390 SYVGNRQDTAEAIEFYRQGLIKAPYKIVGLSELQKVYDMMIAGNVAGRYVVDTSR 444 >gb|EXL47300.1| alcohol dehydrogenase [Fusarium oxysporum f. sp. radicis-lycopersici 26381] Length = 444 Score = 94.4 bits (233), Expect = 2e-17 Identities = 43/55 (78%), Positives = 52/55 (94%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNR+DT+EAIEF+R+GLIKAPYK+VGLSELQKVYD+M G +AGRYV+DTS+ Sbjct: 390 SYVGNRQDTAEAIEFYRQGLIKAPYKIVGLSELQKVYDMMIAGNVAGRYVVDTSR 444 >gb|EXK87424.1| alcohol dehydrogenase [Fusarium oxysporum f. sp. raphani 54005] Length = 444 Score = 94.4 bits (233), Expect = 2e-17 Identities = 43/55 (78%), Positives = 52/55 (94%) Frame = -2 Query: 235 SYVGNRKDTSEAIEFFRKGLIKAPYKVVGLSELQKVYDLMQKGQIAGRYVLDTSK 71 SYVGNR+DT+EAIEF+R+GLIKAPYK+VGLSELQKVYD+M G +AGRYV+DTS+ Sbjct: 390 SYVGNRQDTAEAIEFYRQGLIKAPYKIVGLSELQKVYDMMIAGNVAGRYVVDTSR 444