BLASTX nr result
ID: Cocculus23_contig00021998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00021998 (534 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531010.1| DUF26 domain-containing protein 1 precursor,... 59 1e-06 ref|XP_003552879.1| PREDICTED: cysteine-rich repeat secretory pr... 56 5e-06 emb|CBI33463.3| unnamed protein product [Vitis vinifera] 56 5e-06 ref|XP_002263857.1| PREDICTED: cysteine-rich repeat secretory pr... 56 5e-06 gb|EXC05432.1| hypothetical protein L484_005025 [Morus notabilis] 56 6e-06 ref|XP_007163380.1| hypothetical protein PHAVU_001G229800g [Phas... 56 6e-06 ref|XP_006379773.1| hypothetical protein POPTR_0008s13300g [Popu... 56 6e-06 ref|XP_007215779.1| hypothetical protein PRUPE_ppa009688mg [Prun... 55 8e-06 >ref|XP_002531010.1| DUF26 domain-containing protein 1 precursor, putative [Ricinus communis] gi|223529408|gb|EEF31370.1| DUF26 domain-containing protein 1 precursor, putative [Ricinus communis] Length = 282 Score = 58.5 bits (140), Expect = 1e-06 Identities = 30/47 (63%), Positives = 38/47 (80%), Gaps = 2/47 (4%) Frame = -1 Query: 525 YSKSDHSD--TDEAERAFAITIGLLAGVAVLIVFLAFLRKAFEGKGK 391 Y+KS H+D T+E E+ FAI IGLLAGVA++I+FL F+RK FEG GK Sbjct: 237 YTKS-HNDKSTNEGEKTFAIIIGLLAGVALIIIFLTFIRKVFEGSGK 282 >ref|XP_003552879.1| PREDICTED: cysteine-rich repeat secretory protein 60-like isoform X1 [Glycine max] Length = 281 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = -1 Query: 528 DYSKSDHSDTDEAERAFAITIGLLAGVAVLIVFLAFLRKAFEGKGK 391 +Y+K+ +E E+ FAI +GLLAGVA+LI+FLAFLR+ EG GK Sbjct: 236 NYNKAHGKSGNEGEKTFAIIVGLLAGVAILIIFLAFLRRICEGHGK 281 >emb|CBI33463.3| unnamed protein product [Vitis vinifera] Length = 202 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/46 (56%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -1 Query: 525 YSKSDH-SDTDEAERAFAITIGLLAGVAVLIVFLAFLRKAFEGKGK 391 Y+ +H S D+ E+ FAI +GLLAGVA++I+FL F+RK FEG GK Sbjct: 157 YAHPNHDSSHDDGEKTFAIIVGLLAGVALIIIFLTFMRKVFEGNGK 202 >ref|XP_002263857.1| PREDICTED: cysteine-rich repeat secretory protein 60-like [Vitis vinifera] Length = 283 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/46 (56%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -1 Query: 525 YSKSDH-SDTDEAERAFAITIGLLAGVAVLIVFLAFLRKAFEGKGK 391 Y+ +H S D+ E+ FAI +GLLAGVA++I+FL F+RK FEG GK Sbjct: 238 YAHPNHDSSHDDGEKTFAIIVGLLAGVALIIIFLTFMRKVFEGNGK 283 >gb|EXC05432.1| hypothetical protein L484_005025 [Morus notabilis] Length = 332 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -1 Query: 525 YSKSDHS-DTDEAERAFAITIGLLAGVAVLIVFLAFLRKAFEG 400 YSK+ H TD+ E+ FAI IGLLAGVA++I+FLAFLRK EG Sbjct: 249 YSKTHHDKSTDDGEKTFAIIIGLLAGVALIIIFLAFLRKICEG 291 >ref|XP_007163380.1| hypothetical protein PHAVU_001G229800g [Phaseolus vulgaris] gi|561036844|gb|ESW35374.1| hypothetical protein PHAVU_001G229800g [Phaseolus vulgaris] Length = 283 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/46 (58%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -1 Query: 525 YSKSDHSDTD-EAERAFAITIGLLAGVAVLIVFLAFLRKAFEGKGK 391 Y+ H +D E E+ FAI +GLLAGVA+LI+FLAFLR+ EG+GK Sbjct: 238 YNNKAHGKSDNEGEKTFAIIVGLLAGVAILIIFLAFLRRICEGQGK 283 >ref|XP_006379773.1| hypothetical protein POPTR_0008s13300g [Populus trichocarpa] gi|118487640|gb|ABK95645.1| unknown [Populus trichocarpa] gi|550332974|gb|ERP57570.1| hypothetical protein POPTR_0008s13300g [Populus trichocarpa] Length = 302 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 513 DHSDTDEAERAFAITIGLLAGVAVLIVFLAFLRKAFEGKGK 391 DH + DE E+ AI +GL+AGVA+LIVFLAFLRKA GKGK Sbjct: 244 DHDENDEVEKTLAILVGLIAGVALLIVFLAFLRKAC-GKGK 283 >ref|XP_007215779.1| hypothetical protein PRUPE_ppa009688mg [Prunus persica] gi|462411929|gb|EMJ16978.1| hypothetical protein PRUPE_ppa009688mg [Prunus persica] Length = 282 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/45 (60%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 525 YSKSDHS-DTDEAERAFAITIGLLAGVAVLIVFLAFLRKAFEGKG 394 YSK H T+++E+ FA+ IGLLAGVA+LIVFL F+RK F G G Sbjct: 237 YSKGHHDKSTNDSEKTFAVIIGLLAGVALLIVFLTFIRKVFGGNG 281