BLASTX nr result
ID: Cocculus23_contig00021864
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00021864 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846051.1| hypothetical protein AMTR_s00012p00053550 [A... 77 3e-12 ref|XP_004968225.1| PREDICTED: uncharacterized protein LOC101786... 76 4e-12 ref|XP_007016488.1| Uncharacterized protein isoform 3 [Theobroma... 76 6e-12 ref|XP_007016486.1| Uncharacterized protein isoform 1 [Theobroma... 76 6e-12 ref|XP_007016487.1| Uncharacterized protein isoform 2 [Theobroma... 75 1e-11 ref|XP_007205447.1| hypothetical protein PRUPE_ppa007858mg [Prun... 75 1e-11 ref|XP_007205446.1| hypothetical protein PRUPE_ppa007858mg [Prun... 75 1e-11 tpg|DAA53454.1| TPA: hypothetical protein ZEAMMB73_359391 [Zea m... 74 2e-11 ref|XP_003539689.1| PREDICTED: uncharacterized protein LOC100775... 74 2e-11 ref|NP_001143414.1| uncharacterized protein LOC100276061 [Zea ma... 74 2e-11 ref|XP_006363387.1| PREDICTED: uncharacterized protein LOC102591... 74 2e-11 ref|XP_004251322.1| PREDICTED: uncharacterized protein LOC101266... 74 2e-11 gb|AFK33580.1| unknown [Medicago truncatula] 74 2e-11 ref|XP_003606658.1| hypothetical protein MTR_4g063570 [Medicago ... 74 2e-11 ref|XP_003606657.1| hypothetical protein MTR_4g063570 [Medicago ... 74 2e-11 ref|XP_003606656.1| hypothetical protein MTR_4g063570 [Medicago ... 74 2e-11 ref|XP_002457360.1| hypothetical protein SORBIDRAFT_03g005990 [S... 74 2e-11 ref|XP_006590343.1| PREDICTED: uncharacterized protein LOC100815... 74 3e-11 ref|NP_001241933.1| uncharacterized protein LOC100815374 [Glycin... 73 4e-11 ref|XP_002284193.1| PREDICTED: uncharacterized protein LOC100260... 73 4e-11 >ref|XP_006846051.1| hypothetical protein AMTR_s00012p00053550 [Amborella trichopoda] gi|548848821|gb|ERN07726.1| hypothetical protein AMTR_s00012p00053550 [Amborella trichopoda] Length = 307 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/54 (68%), Positives = 40/54 (74%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQ+N RRFFSLF YL EDV LVP R+NKIP+Q R LL L Sbjct: 142 GATNVFWIDIQSNKRRFFSLFRYLFEDVTLVPLRINKIPLQSRRDLYLLLSRFL 195 >ref|XP_004968225.1| PREDICTED: uncharacterized protein LOC101786065 [Setaria italica] Length = 359 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/54 (68%), Positives = 40/54 (74%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQTNTR F SL+HYLLEDVALVP RLNKI +Q LL + Sbjct: 139 GATNVFWIDIQTNTRHFLSLYHYLLEDVALVPDRLNKISLQAGRDLFLLLSRFM 192 >ref|XP_007016488.1| Uncharacterized protein isoform 3 [Theobroma cacao] gi|508786851|gb|EOY34107.1| Uncharacterized protein isoform 3 [Theobroma cacao] Length = 292 Score = 75.9 bits (185), Expect = 6e-12 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQ+NTRRF SLF YLLE+VAL PTRLNKIP+Q + LL + Sbjct: 145 GATNVFWIDIQSNTRRFQSLFQYLLEEVALEPTRLNKIPVQAQRDLYLLLSRFI 198 >ref|XP_007016486.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508786849|gb|EOY34105.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 358 Score = 75.9 bits (185), Expect = 6e-12 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQ+NTRRF SLF YLLE+VAL PTRLNKIP+Q + LL + Sbjct: 145 GATNVFWIDIQSNTRRFQSLFQYLLEEVALEPTRLNKIPVQAQRDLYLLLSRFI 198 >ref|XP_007016487.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508786850|gb|EOY34106.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 276 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELL 152 GATNVFWIDIQ+NTRRF SLF YLLE+VAL PTRLNKIP+Q + LL Sbjct: 145 GATNVFWIDIQSNTRRFQSLFQYLLEEVALEPTRLNKIPVQQAQRDLYLL 194 >ref|XP_007205447.1| hypothetical protein PRUPE_ppa007858mg [Prunus persica] gi|462401089|gb|EMJ06646.1| hypothetical protein PRUPE_ppa007858mg [Prunus persica] Length = 353 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/54 (68%), Positives = 41/54 (75%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWID Q+NTRRF SLF YLLEDVAL P RLNKIP+QV+ LL + Sbjct: 139 GATNVFWIDTQSNTRRFQSLFRYLLEDVALEPKRLNKIPVQVQRDLFLLLSRFI 192 >ref|XP_007205446.1| hypothetical protein PRUPE_ppa007858mg [Prunus persica] gi|462401088|gb|EMJ06645.1| hypothetical protein PRUPE_ppa007858mg [Prunus persica] Length = 321 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/54 (68%), Positives = 41/54 (75%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWID Q+NTRRF SLF YLLEDVAL P RLNKIP+QV+ LL + Sbjct: 107 GATNVFWIDTQSNTRRFQSLFRYLLEDVALEPKRLNKIPVQVQRDLFLLLSRFI 160 >tpg|DAA53454.1| TPA: hypothetical protein ZEAMMB73_359391 [Zea mays] Length = 360 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/54 (66%), Positives = 40/54 (74%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQTNTR F SL+HYLLEDVALVP RL+KI +Q LL + Sbjct: 139 GATNVFWIDIQTNTRHFLSLYHYLLEDVALVPERLSKISLQAGRDLFLLLSRFM 192 >ref|XP_003539689.1| PREDICTED: uncharacterized protein LOC100775283 [Glycine max] Length = 358 Score = 74.3 bits (181), Expect = 2e-11 Identities = 37/54 (68%), Positives = 40/54 (74%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQTNTRRF SLF YLLEDVAL TRLNKIP Q + +L + Sbjct: 143 GATNVFWIDIQTNTRRFQSLFRYLLEDVALDHTRLNKIPFQAQRDTYLMLSRFI 196 >ref|NP_001143414.1| uncharacterized protein LOC100276061 [Zea mays] gi|195620048|gb|ACG31854.1| hypothetical protein [Zea mays] Length = 359 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/54 (66%), Positives = 40/54 (74%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQTNTR F SL+HYLLEDVALVP RL+KI +Q LL + Sbjct: 139 GATNVFWIDIQTNTRHFLSLYHYLLEDVALVPERLSKISLQAGRDLFLLLSRFM 192 >ref|XP_006363387.1| PREDICTED: uncharacterized protein LOC102591980 [Solanum tuberosum] Length = 357 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVR 131 GATNVFWIDIQTNTRRF SLF YLLE+VALVP RL KIP+Q + Sbjct: 141 GATNVFWIDIQTNTRRFQSLFKYLLEEVALVPDRLKKIPLQAQ 183 >ref|XP_004251322.1| PREDICTED: uncharacterized protein LOC101266600 [Solanum lycopersicum] Length = 357 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVR 131 GATNVFWIDIQTNTRRF SLF YLLE+VALVP RL KIP+Q + Sbjct: 141 GATNVFWIDIQTNTRRFQSLFKYLLEEVALVPDRLKKIPLQAQ 183 >gb|AFK33580.1| unknown [Medicago truncatula] Length = 280 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/54 (66%), Positives = 41/54 (75%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQTNTRRF S+F YLL+DVAL TRLNKIP+Q + LL + Sbjct: 143 GATNVFWIDIQTNTRRFQSIFRYLLDDVALDHTRLNKIPLQAQRDMYLLLSRFI 196 >ref|XP_003606658.1| hypothetical protein MTR_4g063570 [Medicago truncatula] gi|355507713|gb|AES88855.1| hypothetical protein MTR_4g063570 [Medicago truncatula] Length = 266 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/54 (66%), Positives = 41/54 (75%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQTNTRRF S+F YLL+DVAL TRLNKIP+Q + LL + Sbjct: 143 GATNVFWIDIQTNTRRFQSIFRYLLDDVALDHTRLNKIPLQAQRDMYLLLSRFI 196 >ref|XP_003606657.1| hypothetical protein MTR_4g063570 [Medicago truncatula] gi|355507712|gb|AES88854.1| hypothetical protein MTR_4g063570 [Medicago truncatula] Length = 358 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/54 (66%), Positives = 41/54 (75%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQTNTRRF S+F YLL+DVAL TRLNKIP+Q + LL + Sbjct: 143 GATNVFWIDIQTNTRRFQSIFRYLLDDVALDHTRLNKIPLQAQRDMYLLLSRFI 196 >ref|XP_003606656.1| hypothetical protein MTR_4g063570 [Medicago truncatula] gi|355507711|gb|AES88853.1| hypothetical protein MTR_4g063570 [Medicago truncatula] Length = 378 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/54 (66%), Positives = 41/54 (75%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQTNTRRF S+F YLL+DVAL TRLNKIP+Q + LL + Sbjct: 143 GATNVFWIDIQTNTRRFQSIFRYLLDDVALDHTRLNKIPLQAQRDMYLLLSRFI 196 >ref|XP_002457360.1| hypothetical protein SORBIDRAFT_03g005990 [Sorghum bicolor] gi|241929335|gb|EES02480.1| hypothetical protein SORBIDRAFT_03g005990 [Sorghum bicolor] Length = 359 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/54 (66%), Positives = 39/54 (72%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQTNTR F SL+HYLLEDVALVP RL KI +Q LL + Sbjct: 139 GATNVFWIDIQTNTRHFLSLYHYLLEDVALVPDRLTKISLQAGRDLFLLLSRFM 192 >ref|XP_006590343.1| PREDICTED: uncharacterized protein LOC100815374 isoform X1 [Glycine max] gi|571486448|ref|XP_006590344.1| PREDICTED: uncharacterized protein LOC100815374 isoform X2 [Glycine max] Length = 392 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/54 (68%), Positives = 39/54 (72%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQTNTRRF SLF YLLEDV L TRLNKIP Q + LL + Sbjct: 177 GATNVFWIDIQTNTRRFQSLFRYLLEDVGLDHTRLNKIPFQAQRDMYLLLSRFI 230 >ref|NP_001241933.1| uncharacterized protein LOC100815374 [Glycine max] gi|255645052|gb|ACU23025.1| unknown [Glycine max] Length = 358 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/54 (66%), Positives = 39/54 (72%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQTNTRRF SLF YLLEDV L TRLNK+P Q + LL + Sbjct: 143 GATNVFWIDIQTNTRRFQSLFRYLLEDVGLDHTRLNKVPFQAQRDMYLLLSRFI 196 >ref|XP_002284193.1| PREDICTED: uncharacterized protein LOC100260346 [Vitis vinifera] gi|297746114|emb|CBI16170.3| unnamed protein product [Vitis vinifera] Length = 357 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/54 (68%), Positives = 40/54 (74%) Frame = +3 Query: 3 GATNVFWIDIQTNTRRFFSLFHYLLEDVALVPTRLNKIPMQVRHSRVELLEMLL 164 GATNVFWIDIQTNT RF SLF YLLE+VALVPTRLNKI Q + LL + Sbjct: 142 GATNVFWIDIQTNTMRFQSLFRYLLEEVALVPTRLNKIAPQAQRDLYLLLSRFI 195