BLASTX nr result
ID: Cocculus23_contig00021737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00021737 (681 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511263.1| transferase, transferring glycosyl groups, p... 62 2e-07 ref|XP_007037863.1| Glucan synthase-like 8 isoform 3 [Theobroma ... 61 3e-07 ref|XP_007037862.1| Glucan synthase-like 8 isoform 2 [Theobroma ... 61 3e-07 ref|XP_007037861.1| Glucan synthase-like 8 isoform 1 [Theobroma ... 61 3e-07 gb|EYU40120.1| hypothetical protein MIMGU_mgv1a000075mg [Mimulus... 60 7e-07 gb|EXB90589.1| Callose synthase 10 [Morus notabilis] 59 1e-06 ref|XP_002275118.2| PREDICTED: callose synthase 10 [Vitis vinifera] 57 7e-06 ref|XP_003638528.1| Callose synthase, partial [Medicago truncatu... 57 7e-06 emb|CBI14881.3| unnamed protein product [Vitis vinifera] 57 7e-06 ref|XP_004501831.1| PREDICTED: callose synthase 10-like [Cicer a... 56 1e-05 ref|XP_002322219.1| GLUCAN SYNTHASE-LIKE 8 family protein [Popul... 56 1e-05 >ref|XP_002511263.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223550378|gb|EEF51865.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 1876 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 681 ALCLVVYFTDLSIPDLFASILAFIPTGWAIICVS 580 ALCLVV FTDL+I DLFASILAFIPTGWAI+C++ Sbjct: 1767 ALCLVVAFTDLTIADLFASILAFIPTGWAILCLA 1800 >ref|XP_007037863.1| Glucan synthase-like 8 isoform 3 [Theobroma cacao] gi|508775108|gb|EOY22364.1| Glucan synthase-like 8 isoform 3 [Theobroma cacao] Length = 1860 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 681 ALCLVVYFTDLSIPDLFASILAFIPTGWAIICVS 580 ALCLVV FTDLSI DLFASILAFIPTGW I+C++ Sbjct: 1751 ALCLVVAFTDLSIADLFASILAFIPTGWTILCLA 1784 >ref|XP_007037862.1| Glucan synthase-like 8 isoform 2 [Theobroma cacao] gi|508775107|gb|EOY22363.1| Glucan synthase-like 8 isoform 2 [Theobroma cacao] Length = 1901 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 681 ALCLVVYFTDLSIPDLFASILAFIPTGWAIICVS 580 ALCLVV FTDLSI DLFASILAFIPTGW I+C++ Sbjct: 1792 ALCLVVAFTDLSIADLFASILAFIPTGWTILCLA 1825 >ref|XP_007037861.1| Glucan synthase-like 8 isoform 1 [Theobroma cacao] gi|508775106|gb|EOY22362.1| Glucan synthase-like 8 isoform 1 [Theobroma cacao] Length = 1900 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 681 ALCLVVYFTDLSIPDLFASILAFIPTGWAIICVS 580 ALCLVV FTDLSI DLFASILAFIPTGW I+C++ Sbjct: 1791 ALCLVVAFTDLSIADLFASILAFIPTGWTILCLA 1824 >gb|EYU40120.1| hypothetical protein MIMGU_mgv1a000075mg [Mimulus guttatus] Length = 1895 Score = 60.1 bits (144), Expect = 7e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 681 ALCLVVYFTDLSIPDLFASILAFIPTGWAIICVS 580 ALCLVV+FTDLSIPDLFAS LAFIPTGW I+ ++ Sbjct: 1783 ALCLVVFFTDLSIPDLFASFLAFIPTGWFILSLA 1816 >gb|EXB90589.1| Callose synthase 10 [Morus notabilis] Length = 2059 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 681 ALCLVVYFTDLSIPDLFASILAFIPTGWAIICVS 580 A+ LVV FTDLSI DLFASILAFIPTGWAIIC++ Sbjct: 1950 AITLVVIFTDLSIADLFASILAFIPTGWAIICLA 1983 >ref|XP_002275118.2| PREDICTED: callose synthase 10 [Vitis vinifera] Length = 1924 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 681 ALCLVVYFTDLSIPDLFASILAFIPTGWAIICVS 580 ALCLVV FTDLSI DLFASILAFIPTGW I+ ++ Sbjct: 1815 ALCLVVAFTDLSIVDLFASILAFIPTGWMILSLA 1848 >ref|XP_003638528.1| Callose synthase, partial [Medicago truncatula] gi|355504463|gb|AES85666.1| Callose synthase, partial [Medicago truncatula] Length = 673 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 681 ALCLVVYFTDLSIPDLFASILAFIPTGWAIICVS 580 A+CLVV FT LSIPDLFASILAFIPTGW I+ ++ Sbjct: 564 AVCLVVAFTPLSIPDLFASILAFIPTGWGILSLA 597 >emb|CBI14881.3| unnamed protein product [Vitis vinifera] Length = 1694 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 681 ALCLVVYFTDLSIPDLFASILAFIPTGWAIICVS 580 ALCLVV FTDLSI DLFASILAFIPTGW I+ ++ Sbjct: 1585 ALCLVVAFTDLSIVDLFASILAFIPTGWMILSLA 1618 >ref|XP_004501831.1| PREDICTED: callose synthase 10-like [Cicer arietinum] Length = 1902 Score = 56.2 bits (134), Expect = 1e-05 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 681 ALCLVVYFTDLSIPDLFASILAFIPTGWAIICVS 580 A+CLVV FT L+IPDLFASILAFIPTGW I+ ++ Sbjct: 1793 AVCLVVVFTQLTIPDLFASILAFIPTGWGILSLA 1826 >ref|XP_002322219.1| GLUCAN SYNTHASE-LIKE 8 family protein [Populus trichocarpa] gi|222869215|gb|EEF06346.1| GLUCAN SYNTHASE-LIKE 8 family protein [Populus trichocarpa] Length = 1901 Score = 56.2 bits (134), Expect = 1e-05 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 681 ALCLVVYFTDLSIPDLFASILAFIPTGWAIICVS 580 ALCL+V FTDLSIPDLFAS LAFI TGW I+ ++ Sbjct: 1791 ALCLIVAFTDLSIPDLFASFLAFIATGWTILSIA 1824