BLASTX nr result
ID: Cocculus23_contig00021576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00021576 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB80244.1| hypothetical protein L484_025093 [Morus notabilis] 72 6e-11 gb|ADN33672.1| hypothetical protein [Cucumis melo subsp. melo] 57 3e-06 >gb|EXB80244.1| hypothetical protein L484_025093 [Morus notabilis] Length = 527 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/116 (25%), Positives = 63/116 (54%) Frame = -2 Query: 433 LLIFRSTSRVDWVDVERELSARLYQKIELRPVADDRAMLWYHNEEDKYLLLSDDPFYMQN 254 ++ +R W ++ + LS +L +K+ + P+ DRA+LW ++ ++ L+ + +++N Sbjct: 166 VVAYRDWMEEGWTEISKGLSEKLERKVRVSPLFADRAILWCQSDYERDTLVKEGSVHIRN 225 Query: 253 YHMVEVKDWSREGHTTK*KVSSWNDWIGVEGIMVDVWTMNFFKEIRSYCGGMIEVA 86 H + +K W E H K+ WIG+E + + +W + F I + GG++ +A Sbjct: 226 QHAITIKRWCIETHWKNVKIEGRASWIGIEVLPLHMWNSHTFNVIGNKLGGLLNMA 281 >gb|ADN33672.1| hypothetical protein [Cucumis melo subsp. melo] Length = 494 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/107 (24%), Positives = 54/107 (50%) Frame = -2 Query: 403 DWVDVERELSARLYQKIELRPVADDRAMLWYHNEEDKYLLLSDDPFYMQNYHMVEVKDWS 224 DW + +L+ +L + +P ++A++ + + E L+ + + V+ ++W+ Sbjct: 142 DWEKIVEKLNEQLDTTVSYKPFHANKALICFKDFEQANLICKNKGWTTVGRFYVKFEEWN 201 Query: 223 REGHTTK*KVSSWNDWIGVEGIMVDVWTMNFFKEIRSYCGGMIEVAK 83 ++ H + V S+ WI V + + W + F +I CGG +EVAK Sbjct: 202 QKDHASPKFVPSYGGWIKVRAVPLHAWNLESFVQIGDACGGFMEVAK 248