BLASTX nr result
ID: Cocculus23_contig00021531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00021531 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551304.1| PREDICTED: phosphomethylpyrimidine synthase,... 52 4e-06 ref|XP_006602098.1| PREDICTED: phosphomethylpyrimidine synthase,... 52 4e-06 >ref|XP_003551304.1| PREDICTED: phosphomethylpyrimidine synthase, chloroplastic-like isoform X1 [Glycine max] Length = 647 Score = 51.6 bits (122), Expect(2) = 4e-06 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = +2 Query: 233 SKLLNTSFLPGFDVVGNVSGAREKEASPIPLSFIPRATATFE 358 SK ++SFLPGFDVVG S A +KE P +S +PRAT TF+ Sbjct: 22 SKFTSSSFLPGFDVVGRASNAWKKELVPSSISLVPRATLTFD 63 Score = 24.6 bits (52), Expect(2) = 4e-06 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +3 Query: 156 MASINSALTTVVCKKSNY 209 MAS+++ +T+VVCK N+ Sbjct: 1 MASLHANVTSVVCKSGNH 18 >ref|XP_006602098.1| PREDICTED: phosphomethylpyrimidine synthase, chloroplastic-like isoform X2 [Glycine max] Length = 646 Score = 51.6 bits (122), Expect(2) = 4e-06 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = +2 Query: 233 SKLLNTSFLPGFDVVGNVSGAREKEASPIPLSFIPRATATFE 358 SK ++SFLPGFDVVG S A +KE P +S +PRAT TF+ Sbjct: 22 SKFTSSSFLPGFDVVGRASNAWKKELVPSSISLVPRATLTFD 63 Score = 24.6 bits (52), Expect(2) = 4e-06 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +3 Query: 156 MASINSALTTVVCKKSNY 209 MAS+++ +T+VVCK N+ Sbjct: 1 MASLHANVTSVVCKSGNH 18