BLASTX nr result
ID: Cocculus23_contig00021467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00021467 (467 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002311041.1| hypothetical protein POPTR_0008s02620g [Popu... 62 8e-08 ref|XP_002530891.1| cysteine-type peptidase, putative [Ricinus c... 62 1e-07 ref|XP_002316423.1| hypothetical protein POPTR_0010s24050g [Popu... 61 2e-07 ref|XP_006360486.1| PREDICTED: uncharacterized protein LOC102606... 60 2e-07 ref|XP_004250001.1| PREDICTED: uncharacterized protein LOC101253... 60 2e-07 ref|XP_006436685.1| hypothetical protein CICLE_v10032126mg [Citr... 59 9e-07 ref|XP_004307032.1| PREDICTED: OTU domain-containing protein At3... 57 2e-06 gb|EXC25419.1| hypothetical protein L484_016802 [Morus notabilis] 57 3e-06 ref|XP_006851714.1| hypothetical protein AMTR_s00040p00212010 [A... 57 3e-06 ref|XP_002267087.2| PREDICTED: uncharacterized protein LOC100245... 56 5e-06 emb|CBI40221.3| unnamed protein product [Vitis vinifera] 56 5e-06 ref|XP_007220473.1| hypothetical protein PRUPE_ppa008484mg [Prun... 56 6e-06 >ref|XP_002311041.1| hypothetical protein POPTR_0008s02620g [Populus trichocarpa] gi|222850861|gb|EEE88408.1| hypothetical protein POPTR_0008s02620g [Populus trichocarpa] Length = 326 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -2 Query: 466 VFMMDRSLGNLMNISSDGKEYAKDEKSLIQVLFHG*SHYDVLETLRAKS 320 VFM DR+ GNL+NI++ G+EY KDE + I VLFHG HYD+LET +S Sbjct: 272 VFMRDRTTGNLVNIANYGEEYRKDEVNPINVLFHGYGHYDILETTPGQS 320 >ref|XP_002530891.1| cysteine-type peptidase, putative [Ricinus communis] gi|223529544|gb|EEF31497.1| cysteine-type peptidase, putative [Ricinus communis] Length = 185 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -2 Query: 466 VFMMDRSLGNLMNISSDGKEYAKDEKSLIQVLFHG*SHYDVLET 335 VFM+DR+ GNL+NI++ G+EY KDE + I VLFHG HYD+LET Sbjct: 132 VFMIDRASGNLVNIANYGEEYRKDEVNPINVLFHGYGHYDILET 175 >ref|XP_002316423.1| hypothetical protein POPTR_0010s24050g [Populus trichocarpa] gi|222865463|gb|EEF02594.1| hypothetical protein POPTR_0010s24050g [Populus trichocarpa] Length = 318 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = -2 Query: 466 VFMMDRSLGNLMNISSDGKEYAKDEKSLIQVLFHG*SHYDVLETLRAKS 320 VFM DR+ GNL+NI + G+EY KDE + I VLFHG HYD+LET +S Sbjct: 264 VFMRDRTTGNLVNIVNYGEEYQKDEVNPINVLFHGYGHYDILETTPGQS 312 >ref|XP_006360486.1| PREDICTED: uncharacterized protein LOC102606023 isoform X1 [Solanum tuberosum] Length = 338 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -2 Query: 466 VFMMDRSLGNLMNISSDGKEYAKDEKSLIQVLFHG*SHYDVLETLRAK 323 V+M+DRS G+L+NIS+ G+EY K+ +S I VLFHG HYD+LET+ K Sbjct: 284 VYMVDRSSGSLINISNYGEEYRKEGESPINVLFHGYGHYDILETIPEK 331 >ref|XP_004250001.1| PREDICTED: uncharacterized protein LOC101253339 [Solanum lycopersicum] Length = 338 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -2 Query: 466 VFMMDRSLGNLMNISSDGKEYAKDEKSLIQVLFHG*SHYDVLETLRAK 323 V+M+DRS G+L+NIS+ G+EY K+ +S I VLFHG HYD+LET+ K Sbjct: 284 VYMVDRSSGSLINISNYGEEYRKEGESPINVLFHGYGHYDILETIPEK 331 >ref|XP_006436685.1| hypothetical protein CICLE_v10032126mg [Citrus clementina] gi|568878376|ref|XP_006492172.1| PREDICTED: uncharacterized protein LOC102630016 [Citrus sinensis] gi|557538881|gb|ESR49925.1| hypothetical protein CICLE_v10032126mg [Citrus clementina] Length = 322 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -2 Query: 466 VFMMDRSLGNLMNISSDGKEYAKDEKSLIQVLFHG*SHYDVLET 335 VFM+ +S GNL+NI++ G+EY KD++S I VLFHG HYD+LET Sbjct: 274 VFMVVQSSGNLVNIANYGEEYQKDKESPINVLFHGYGHYDILET 317 >ref|XP_004307032.1| PREDICTED: OTU domain-containing protein At3g57810-like [Fragaria vesca subsp. vesca] Length = 324 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = -2 Query: 466 VFMMDRSLGNLMNISSDGKEYAKDEKSLIQVLFHG*SHYDVLETLRAKS 320 V+M+DRS G L+NI+ G+EY K E+ I VLFHG HYD+LE+ +S Sbjct: 270 VYMVDRSSGGLVNIAKYGEEYGKQEEKPINVLFHGYGHYDILESFSEQS 318 >gb|EXC25419.1| hypothetical protein L484_016802 [Morus notabilis] Length = 338 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = -2 Query: 466 VFMMDRSLGNLMNISSDGKE-YAKDEKSLIQVLFHG*SHYDVLETLRAKS 320 VFM DRS G L+NI+ G+E Y KDE++ I VLFHG HYD+LET KS Sbjct: 280 VFMRDRSTGALVNIAKYGEEEYGKDEQNPINVLFHGYGHYDILETPSDKS 329 >ref|XP_006851714.1| hypothetical protein AMTR_s00040p00212010 [Amborella trichopoda] gi|548855294|gb|ERN13181.1| hypothetical protein AMTR_s00040p00212010 [Amborella trichopoda] Length = 332 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = -2 Query: 466 VFMMDRSLGNLMNISSDGKEYAKDEKSLIQVLFHG*SHYDVLE 338 VFMMD++LG L+NI++ G+EY K++ S I+VL+HG HYD LE Sbjct: 286 VFMMDKNLGGLINIANYGQEYGKEKDSPIKVLYHGYGHYDALE 328 >ref|XP_002267087.2| PREDICTED: uncharacterized protein LOC100245448 [Vitis vinifera] Length = 380 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -2 Query: 466 VFMMDRSLGNLMNISSDGKEYAKDEKSLIQVLFHG*SHYDVLET 335 VFM+ RS G+L NI++ GKEY D +S I VLFHG HYD+LET Sbjct: 326 VFMIGRSSGDLKNIANYGKEYRIDNESPINVLFHGYGHYDILET 369 >emb|CBI40221.3| unnamed protein product [Vitis vinifera] Length = 317 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -2 Query: 466 VFMMDRSLGNLMNISSDGKEYAKDEKSLIQVLFHG*SHYDVLET 335 VFM+ RS G+L NI++ GKEY D +S I VLFHG HYD+LET Sbjct: 263 VFMIGRSSGDLKNIANYGKEYRIDNESPINVLFHGYGHYDILET 306 >ref|XP_007220473.1| hypothetical protein PRUPE_ppa008484mg [Prunus persica] gi|462416935|gb|EMJ21672.1| hypothetical protein PRUPE_ppa008484mg [Prunus persica] Length = 329 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/49 (51%), Positives = 36/49 (73%) Frame = -2 Query: 466 VFMMDRSLGNLMNISSDGKEYAKDEKSLIQVLFHG*SHYDVLETLRAKS 320 VFM+DRS L+NI++ G+EY K+E+ I VLFHG HYD+L++ +S Sbjct: 275 VFMIDRSSAGLVNIANYGEEYRKEEEKPINVLFHGYGHYDILDSFSEQS 323