BLASTX nr result
ID: Cocculus23_contig00021443
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00021443 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843856.1| hypothetical protein AMTR_s00007p00263800 [A... 59 5e-07 emb|CBI35828.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002272087.1| PREDICTED: uncharacterized protein LOC100241... 57 3e-06 ref|XP_007024713.1| Uncharacterized protein TCM_029205 [Theobrom... 56 5e-06 ref|XP_004305766.1| PREDICTED: uncharacterized protein LOC101315... 56 5e-06 ref|XP_007217868.1| hypothetical protein PRUPE_ppa021525mg [Prun... 56 5e-06 ref|XP_002304236.2| hypothetical protein POPTR_0003s06780g [Popu... 56 6e-06 ref|XP_002529183.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_006843856.1| hypothetical protein AMTR_s00007p00263800 [Amborella trichopoda] gi|548846224|gb|ERN05531.1| hypothetical protein AMTR_s00007p00263800 [Amborella trichopoda] Length = 586 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 247 MASLTPGVLLKLLQSINSNIRVCGEYRSVLL 339 MASLTPGVLLKLLQS+NS++RVCGEYRSVLL Sbjct: 1 MASLTPGVLLKLLQSLNSDVRVCGEYRSVLL 31 >emb|CBI35828.3| unnamed protein product [Vitis vinifera] Length = 546 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 247 MASLTPGVLLKLLQSINSNIRVCGEYRSVLL 339 MASLTPGVLLKLLQSINSNI+V GEYRSVLL Sbjct: 1 MASLTPGVLLKLLQSINSNIKVRGEYRSVLL 31 >ref|XP_002272087.1| PREDICTED: uncharacterized protein LOC100241213 [Vitis vinifera] Length = 529 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 247 MASLTPGVLLKLLQSINSNIRVCGEYRSVLL 339 MASLTPGVLLKLLQSINSNI+V GEYRSVLL Sbjct: 1 MASLTPGVLLKLLQSINSNIKVRGEYRSVLL 31 >ref|XP_007024713.1| Uncharacterized protein TCM_029205 [Theobroma cacao] gi|508780079|gb|EOY27335.1| Uncharacterized protein TCM_029205 [Theobroma cacao] Length = 524 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 247 MASLTPGVLLKLLQSINSNIRVCGEYRSVLL 339 MASLTPGVLLKLLQSINSN++V GEYRSVLL Sbjct: 1 MASLTPGVLLKLLQSINSNVKVRGEYRSVLL 31 >ref|XP_004305766.1| PREDICTED: uncharacterized protein LOC101315368 [Fragaria vesca subsp. vesca] Length = 528 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 247 MASLTPGVLLKLLQSINSNIRVCGEYRSVLL 339 MASLTPGVLLKLLQS+NSNI+V GEYRSVLL Sbjct: 1 MASLTPGVLLKLLQSMNSNIKVLGEYRSVLL 31 >ref|XP_007217868.1| hypothetical protein PRUPE_ppa021525mg [Prunus persica] gi|462414018|gb|EMJ19067.1| hypothetical protein PRUPE_ppa021525mg [Prunus persica] Length = 505 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 247 MASLTPGVLLKLLQSINSNIRVCGEYRSVLL 339 MASLTPGVLLKLLQSINSN++V GEYRSVLL Sbjct: 1 MASLTPGVLLKLLQSINSNVKVRGEYRSVLL 31 >ref|XP_002304236.2| hypothetical protein POPTR_0003s06780g [Populus trichocarpa] gi|550342579|gb|EEE79215.2| hypothetical protein POPTR_0003s06780g [Populus trichocarpa] Length = 533 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 247 MASLTPGVLLKLLQSINSNIRVCGEYRSVLL 339 MASLTPGVLLKLL+SINSN+RV GEYRSVLL Sbjct: 1 MASLTPGVLLKLLRSINSNVRVRGEYRSVLL 31 >ref|XP_002529183.1| conserved hypothetical protein [Ricinus communis] gi|223531361|gb|EEF33197.1| conserved hypothetical protein [Ricinus communis] Length = 540 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 247 MASLTPGVLLKLLQSINSNIRVCGEYRSVLL 339 MASLTPGVLLKLLQS+NSNI+V GEYRSVLL Sbjct: 1 MASLTPGVLLKLLQSMNSNIKVRGEYRSVLL 31