BLASTX nr result
ID: Cocculus23_contig00021409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00021409 (295 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203466.1| hypothetical protein PRUPE_ppa023057mg, part... 57 3e-06 >ref|XP_007203466.1| hypothetical protein PRUPE_ppa023057mg, partial [Prunus persica] gi|462398997|gb|EMJ04665.1| hypothetical protein PRUPE_ppa023057mg, partial [Prunus persica] Length = 241 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/83 (36%), Positives = 48/83 (57%), Gaps = 4/83 (4%) Frame = +3 Query: 3 TLDF----GKDFANQTREQFVNTLNRYLQLHRSKSIHRFRLLFHPGIRNQVEAEKWIEFA 170 TLD+ ++ NQ ++VN +NR L+ HR +SI RFR++F + +KWI+FA Sbjct: 25 TLDYFYRLDENILNQEGRKYVNWVNRVLEQHRGRSIERFRVIFFLDKGFTSDIDKWIQFA 84 Query: 171 TQRLVKDLEIDFCGRLRNYSSSD 239 ++ V+ L++D NYS D Sbjct: 85 MEKRVQVLQLDLLAEWVNYSPYD 107