BLASTX nr result
ID: Cocculus23_contig00021222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00021222 (912 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006854512.1| hypothetical protein AMTR_s00175p00061780 [A... 41 1e-06 >ref|XP_006854512.1| hypothetical protein AMTR_s00175p00061780 [Amborella trichopoda] gi|548858190|gb|ERN15979.1| hypothetical protein AMTR_s00175p00061780 [Amborella trichopoda] Length = 493 Score = 40.8 bits (94), Expect(2) = 1e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = +1 Query: 1 NERSRDFTNPSLPSGEPKGRSSQVCLYRFGE 93 NERSRDFTNPSLP+ E KGR SQ L +G+ Sbjct: 222 NERSRDFTNPSLPN-EQKGRPSQGALPGYGD 251 Score = 39.3 bits (90), Expect(2) = 1e-06 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +2 Query: 215 PGYGDAGSLYALQPPGAR-VAFQQVGDV 295 PGYGD+G LY +QP G R VAF QVG + Sbjct: 247 PGYGDSGGLYGMQPGGGRPVAFPQVGAI 274