BLASTX nr result
ID: Cocculus23_contig00020491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00020491 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF11490.1| hypothetical protein SEPMUDRAFT_150406 [Sphaeruli... 55 8e-06 >gb|EMF11490.1| hypothetical protein SEPMUDRAFT_150406 [Sphaerulina musiva SO2202] Length = 562 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = -3 Query: 119 GYAEDQNGNLPGYTNADAPFGSYTPLPITTIPASFGPDS 3 G A DQ+GN+ GY NADAP+ S P P+T +P+ FGPDS Sbjct: 77 GNAADQSGNVDGYINADAPYASEQPTPLTVVPSVFGPDS 115