BLASTX nr result
ID: Cocculus23_contig00020398
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00020398 (746 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38896.1| 60S ribosomal protein L18a-1 [Morus notabilis] 60 6e-07 ref|XP_002309204.1| hypothetical protein POPTR_0006s14830g [Popu... 60 6e-07 ref|XP_007012733.1| Ribosomal protein L18ae family [Theobroma ca... 59 2e-06 ref|XP_002324774.1| hypothetical protein POPTR_0018s05410g [Popu... 58 4e-06 ref|XP_002514091.1| conserved hypothetical protein [Ricinus comm... 57 9e-06 >gb|EXB38896.1| 60S ribosomal protein L18a-1 [Morus notabilis] Length = 141 Score = 60.5 bits (145), Expect = 6e-07 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = +3 Query: 9 VEQVEGLRNGLEMVKSVSDKHLDLLRPSARHFAVSKGR 122 VE+ EGLRNG+E+V SVSDKHLDLLRPSAR++++ KG+ Sbjct: 7 VEEAEGLRNGVELVTSVSDKHLDLLRPSARYYSMFKGQ 44 >ref|XP_002309204.1| hypothetical protein POPTR_0006s14830g [Populus trichocarpa] gi|222855180|gb|EEE92727.1| hypothetical protein POPTR_0006s14830g [Populus trichocarpa] Length = 141 Score = 60.5 bits (145), Expect = 6e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = +3 Query: 3 ATVEQVEGLRNGLEMVKSVSDKHLDLLRPSARHFAVSKGR 122 A +E+ +G RNG+E+VKSVSDKH+DLLRPSAR++ SKG+ Sbjct: 5 AAIEERKGFRNGVELVKSVSDKHIDLLRPSARYYTASKGQ 44 >ref|XP_007012733.1| Ribosomal protein L18ae family [Theobroma cacao] gi|508783096|gb|EOY30352.1| Ribosomal protein L18ae family [Theobroma cacao] Length = 141 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 ATVEQVEGLRNGLEMVKSVSDKHLDLLRPSARHFAVSKGR 122 A VE+V LRN LE+ KSVSDKHLDLLRPSAR+++V KG+ Sbjct: 5 AAVEEVGNLRNNLELSKSVSDKHLDLLRPSARYYSVVKGQ 44 >ref|XP_002324774.1| hypothetical protein POPTR_0018s05410g [Populus trichocarpa] gi|222866208|gb|EEF03339.1| hypothetical protein POPTR_0018s05410g [Populus trichocarpa] Length = 146 Score = 57.8 bits (138), Expect = 4e-06 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = +3 Query: 3 ATVEQVEGLRNGLEMVKSVSDKHLDLLRPSARHFAVSK 116 A++++ +G RNG+E VKSVSDKH+DLLRPSAR++A SK Sbjct: 5 ASIDERDGFRNGVEKVKSVSDKHIDLLRPSARYYATSK 42 >ref|XP_002514091.1| conserved hypothetical protein [Ricinus communis] gi|223546547|gb|EEF48045.1| conserved hypothetical protein [Ricinus communis] Length = 142 Score = 56.6 bits (135), Expect = 9e-06 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = +3 Query: 9 VEQVEGLRNGLEMVKSVSDKHLDLLRPSARHFAVSKGR 122 +E+ E LR GLE+VKS SDKH+DLLRPSAR+++ SKG+ Sbjct: 7 IEEKECLRTGLELVKSASDKHIDLLRPSARYYSASKGQ 44