BLASTX nr result
ID: Cocculus23_contig00020339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00020339 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007044930.1| Uncharacterized protein isoform 2 [Theobroma... 55 8e-06 ref|XP_007044929.1| Uncharacterized protein isoform 1 [Theobroma... 55 8e-06 >ref|XP_007044930.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508708865|gb|EOY00762.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 1033 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/47 (65%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = -2 Query: 277 SFDPKNMTLEMIIRGSSSYKKAKLTASQTILG--DSEPVDFVPDSQA 143 S PK+M+L I+R SSSYKKAKLTASQ+ L DS P +FVPDSQA Sbjct: 986 STSPKSMSLHAILRNSSSYKKAKLTASQSQLDDLDSLPDEFVPDSQA 1032 >ref|XP_007044929.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508708864|gb|EOY00761.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 1112 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/47 (65%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = -2 Query: 277 SFDPKNMTLEMIIRGSSSYKKAKLTASQTILG--DSEPVDFVPDSQA 143 S PK+M+L I+R SSSYKKAKLTASQ+ L DS P +FVPDSQA Sbjct: 1065 STSPKSMSLHAILRNSSSYKKAKLTASQSQLDDLDSLPDEFVPDSQA 1111