BLASTX nr result
ID: Cocculus23_contig00018799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00018799 (476 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76904.1| hypothetical protein VITISV_016347 [Vitis vinifera] 69 9e-10 emb|CAN71507.1| hypothetical protein VITISV_015850 [Vitis vinifera] 69 9e-10 emb|CAN80546.1| hypothetical protein VITISV_010897 [Vitis vinifera] 67 3e-09 emb|CAN77073.1| hypothetical protein VITISV_006214 [Vitis vinifera] 67 3e-09 emb|CAN80039.1| hypothetical protein VITISV_040551 [Vitis vinifera] 66 6e-09 emb|CAN65484.1| hypothetical protein VITISV_029474 [Vitis vinifera] 66 6e-09 emb|CAN61757.1| hypothetical protein VITISV_030741 [Vitis vinifera] 65 7e-09 emb|CAN66166.1| hypothetical protein VITISV_000142 [Vitis vinifera] 65 7e-09 emb|CAN63585.1| hypothetical protein VITISV_026806 [Vitis vinifera] 65 7e-09 emb|CAN83313.1| hypothetical protein VITISV_001463 [Vitis vinifera] 65 1e-08 emb|CAN71985.1| hypothetical protein VITISV_011667 [Vitis vinifera] 65 1e-08 emb|CAN81818.1| hypothetical protein VITISV_009635 [Vitis vinifera] 65 1e-08 emb|CAN72359.1| hypothetical protein VITISV_000131 [Vitis vinifera] 65 1e-08 emb|CAN76811.1| hypothetical protein VITISV_044062 [Vitis vinifera] 65 1e-08 emb|CAN79629.1| hypothetical protein VITISV_002584 [Vitis vinifera] 64 2e-08 emb|CAN79190.1| hypothetical protein VITISV_000232 [Vitis vinifera] 64 2e-08 emb|CAN67932.1| hypothetical protein VITISV_013913 [Vitis vinifera] 64 2e-08 emb|CAN82386.1| hypothetical protein VITISV_029348 [Vitis vinifera] 64 3e-08 emb|CAN65957.1| hypothetical protein VITISV_035610 [Vitis vinifera] 64 3e-08 emb|CAN82456.1| hypothetical protein VITISV_010028 [Vitis vinifera] 62 6e-08 >emb|CAN76904.1| hypothetical protein VITISV_016347 [Vitis vinifera] Length = 909 Score = 68.6 bits (166), Expect = 9e-10 Identities = 36/83 (43%), Positives = 52/83 (62%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+FNF R L+ E +D+ S + ++R+ +S +P++ SWS+ SG FT KSFFL L S Sbjct: 716 WNFNFRRNLTDSEIEDLESLMRSLDRLHISPSVPDKRSWSISPSGLFTVKSFFLALSQYS 775 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP I+F+W + VP K SF Sbjct: 776 ESPPVFPIEFVWNSQVPFKVKSF 798 >emb|CAN71507.1| hypothetical protein VITISV_015850 [Vitis vinifera] Length = 311 Score = 68.6 bits (166), Expect = 9e-10 Identities = 38/83 (45%), Positives = 48/83 (57%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+FNF R LS E +D+ + +R+ +S +PN+ SWSL SG FT KSFFL L S Sbjct: 127 WNFNFRRNLSDSEIEDLEGLMRSFDRLHISPSVPNKRSWSLSPSGLFTVKSFFLXLSQYS 186 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP F+W A VP K SF Sbjct: 187 ESPPVFPTKFVWNAQVPFKVKSF 209 >emb|CAN80546.1| hypothetical protein VITISV_010897 [Vitis vinifera] Length = 549 Score = 66.6 bits (161), Expect = 3e-09 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+F F R LS E +D+ + +R+ +SS +P++ SWSL SG FT KSFFL L S Sbjct: 427 WNFTFRRNLSDSEIEDLEGLMQSFDRLHISSSVPDKRSWSLSPSGLFTVKSFFLALSQYS 486 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP F+W A VP K SF Sbjct: 487 ESPPIFPTKFVWNAQVPFKVKSF 509 >emb|CAN77073.1| hypothetical protein VITISV_006214 [Vitis vinifera] Length = 366 Score = 66.6 bits (161), Expect = 3e-09 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+F F R LS E +D+ + +R+ +SS +P++ SWSL SG FT KSFFL L S Sbjct: 178 WNFTFRRNLSDSEIEDLEGLMQSFDRLHISSSVPDKRSWSLSPSGLFTVKSFFLALSQYS 237 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP F+W A VP K SF Sbjct: 238 KSPPIFPTKFVWNAQVPFKVKSF 260 >emb|CAN80039.1| hypothetical protein VITISV_040551 [Vitis vinifera] Length = 536 Score = 65.9 bits (159), Expect = 6e-09 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+F F R LS E +D+ + ++R+ +SS +P++ SW L SG FT KSFFL L S Sbjct: 333 WNFTFRRNLSDSEIEDLEGLMQSLDRLHISSSVPDKRSWFLSPSGLFTVKSFFLALSQYS 392 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP+ F+W A VP K SF Sbjct: 393 ESPTIFPTKFVWNAQVPFKVKSF 415 >emb|CAN65484.1| hypothetical protein VITISV_029474 [Vitis vinifera] Length = 1882 Score = 65.9 bits (159), Expect = 6e-09 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+F F R LS E +D+ + ++R+ +SS +P++ SW L SG FT KSFFL L S Sbjct: 1644 WNFTFRRNLSDSEIEDLEGLMQSLDRLHISSSVPDKRSWFLSPSGLFTVKSFFLALSQYS 1703 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP+ F+W A VP K SF Sbjct: 1704 ESPTIFPTKFVWNAQVPFKVKSF 1726 >emb|CAN61757.1| hypothetical protein VITISV_030741 [Vitis vinifera] Length = 1306 Score = 65.5 bits (158), Expect = 7e-09 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+FNF R L+ E +D+ S + ++R+ +S +P++ SWS+ SG FT KSFFL L S Sbjct: 1068 WNFNFRRNLTDSEIEDLESLMRSLDRLHISPSVPDKRSWSISPSGLFTVKSFFLALSQHS 1127 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP F+W + VP K SF Sbjct: 1128 ESPPVFPTKFVWNSQVPFKVKSF 1150 >emb|CAN66166.1| hypothetical protein VITISV_000142 [Vitis vinifera] Length = 533 Score = 65.5 bits (158), Expect = 7e-09 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+FNF R L+ E +D+ S + ++R+ +S +P++ SWS+ SG FT KSFFL L S Sbjct: 375 WNFNFRRNLTDSEIEDLESLMRSLDRLHISPSVPDKRSWSISPSGLFTVKSFFLALSQHS 434 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP F+W + VP K SF Sbjct: 435 ESPPVFPTKFVWNSQVPFKVKSF 457 >emb|CAN63585.1| hypothetical protein VITISV_026806 [Vitis vinifera] Length = 684 Score = 65.5 bits (158), Expect = 7e-09 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+FNF R L+ E +D+ S + ++R+ +S +P++ SWS+ SG FT KSFFL L S Sbjct: 446 WNFNFRRNLTDSEIEDLESLMRSLDRLHISPSVPDKRSWSISPSGLFTVKSFFLALSQYS 505 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP F+W + VP K SF Sbjct: 506 ESPPVFPTKFVWNSQVPFKVKSF 528 >emb|CAN83313.1| hypothetical protein VITISV_001463 [Vitis vinifera] Length = 1780 Score = 65.1 bits (157), Expect = 1e-08 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+FNF + LS E +D+ + ++R+ +S +P++ SWSL SG FT KSFFL L S Sbjct: 1683 WNFNFRQNLSDSEIEDLEGLMRSLDRLHISPLVPDKRSWSLSPSGLFTVKSFFLALSQYS 1742 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP F+W + VP K SF Sbjct: 1743 ESPPVFPTKFVWNSQVPFKVKSF 1765 >emb|CAN71985.1| hypothetical protein VITISV_011667 [Vitis vinifera] Length = 413 Score = 65.1 bits (157), Expect = 1e-08 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+FNF R L+ E +D+ S + ++R+ +S +P++ SWS+ SG FT KSFFL L S Sbjct: 178 WNFNFRRNLTNSEIEDLESLMRSLDRLHISPSVPDKRSWSIFPSGLFTVKSFFLALSQYS 237 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP F+W + VP K SF Sbjct: 238 ESPPVFPTKFVWNSQVPFKVKSF 260 >emb|CAN81818.1| hypothetical protein VITISV_009635 [Vitis vinifera] Length = 1014 Score = 64.7 bits (156), Expect = 1e-08 Identities = 36/83 (43%), Positives = 47/83 (56%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+F F R LS E +D+ + +R+ +SS +P++ SWSL SG FT KSFFL L S Sbjct: 534 WNFTFRRNLSDSEIEDLEGLMQSFDRLHISSSVPDKRSWSLSPSGLFTVKSFFLALSQYS 593 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 P F+W A VP K SF Sbjct: 594 KPPPIFPTKFVWNAQVPFKVKSF 616 >emb|CAN72359.1| hypothetical protein VITISV_000131 [Vitis vinifera] Length = 772 Score = 64.7 bits (156), Expect = 1e-08 Identities = 36/83 (43%), Positives = 47/83 (56%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+F F R LS E +D+ + +R+ +SS +P++ SWSL SG FT K FFL L S Sbjct: 534 WNFTFRRNLSDSEIEDLEGLMQSFDRLHISSSVPDKRSWSLSPSGLFTVKXFFLALSQYS 593 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP F+W A VP K SF Sbjct: 594 ESPPIFPTKFVWNAQVPFKVKSF 616 >emb|CAN76811.1| hypothetical protein VITISV_044062 [Vitis vinifera] Length = 207 Score = 64.7 bits (156), Expect = 1e-08 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+FNF R LS E +++ S + ++ I +S +P++ SWSL SSG FT KSFFL L S Sbjct: 85 WNFNFRRNLSDSEIEEVESLMQSLDHIHLSPSVPDKRSWSLSSSGLFTVKSFFLALSQIS 144 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 PS +W + VP K SF Sbjct: 145 GLPSVFPTKLVWNSQVPFKIKSF 167 >emb|CAN79629.1| hypothetical protein VITISV_002584 [Vitis vinifera] Length = 964 Score = 64.3 bits (155), Expect = 2e-08 Identities = 35/83 (42%), Positives = 48/83 (57%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+FNF R LS E +D+ + ++R+ +S +P++ SWSL G FT KSFFL L S Sbjct: 606 WNFNFRRNLSDSEIEDLEGLMRSLDRLHISPLVPDKRSWSLSPLGLFTVKSFFLALSQYS 665 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP F+W + VP K SF Sbjct: 666 ESPPVFPTKFVWNSQVPFKVKSF 688 >emb|CAN79190.1| hypothetical protein VITISV_000232 [Vitis vinifera] Length = 1935 Score = 63.9 bits (154), Expect = 2e-08 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+FNF R LS E +++ S + ++ + +S +P++ SWSL SSG FT KSFFL L S Sbjct: 1692 WNFNFRRNLSDSEIEELESLMQSLDHLHLSPXVPDKRSWSLSSSGLFTVKSFFLALSQIS 1751 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 PS +W + VP K SF Sbjct: 1752 GLPSVFPTKLVWNSQVPFKIKSF 1774 >emb|CAN67932.1| hypothetical protein VITISV_013913 [Vitis vinifera] Length = 2077 Score = 63.9 bits (154), Expect = 2e-08 Identities = 35/83 (42%), Positives = 48/83 (57%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+FNF R LS E +D+ + ++R+ +S +P++ SWSL SG F KSFFL L S Sbjct: 1374 WNFNFRRNLSDSEIEDLEGLMRSLDRLHISPSVPDKRSWSLSPSGLFVVKSFFLALSQYS 1433 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP F+W + VP K SF Sbjct: 1434 ESPPVFPTKFVWNSQVPFKVKSF 1456 >emb|CAN82386.1| hypothetical protein VITISV_029348 [Vitis vinifera] Length = 2062 Score = 63.5 bits (153), Expect = 3e-08 Identities = 36/83 (43%), Positives = 48/83 (57%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+FNF R LS E +D+ S + ++ I +S +P++ SWSL SG FT KSFFL L S Sbjct: 1946 WNFNFHRNLSDSEIEDLESLMQSLDHIHLSPSVPDKRSWSLSFSGLFTVKSFFLALSQIS 2005 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 PS +W + VP K SF Sbjct: 2006 GLPSVFPTKLVWNSQVPFKIKSF 2028 >emb|CAN65957.1| hypothetical protein VITISV_035610 [Vitis vinifera] Length = 1532 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 1/79 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+FNF R LS E +++ S + ++ I +S +P++ SWSL SSG FT KSFFL L S Sbjct: 1383 WNFNFRRNLSDSEIEEVESLMQSLDHIHLSPSVPDKRSWSLSSSGLFTVKSFFLALSQIS 1442 Query: 393 PSPSFLRIDFIWKALVP*K 449 PS +W + VP K Sbjct: 1443 GLPSVFPTKLVWNSQVPFK 1461 >emb|CAN82456.1| hypothetical protein VITISV_010028 [Vitis vinifera] Length = 4128 Score = 62.4 bits (150), Expect = 6e-08 Identities = 35/83 (42%), Positives = 47/83 (56%), Gaps = 1/83 (1%) Frame = +3 Query: 216 WDFNFPRALSRREEQDIASFLSCIERICMSSFLPNRVSWSLDSSGHFTFKSFFLNLID-S 392 W+FNF R LS E +D+ + ++R+ +S +P+ SWSL G FT KSFFL L S Sbjct: 3885 WNFNFCRNLSDSEIEDLEGLMRSLDRLHISPSVPDMRSWSLSXXGLFTVKSFFLALSQFS 3944 Query: 393 PSPSFLRIDFIWKALVP*KN*SF 461 SP F+W + VP K SF Sbjct: 3945 DSPPVFPTKFVWNSQVPFKVKSF 3967