BLASTX nr result
ID: Cocculus23_contig00018693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00018693 (497 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007013432.1| Uncharacterized protein isoform 1 [Theobroma... 57 2e-06 ref|XP_007203963.1| hypothetical protein PRUPE_ppa000100mg [Prun... 57 2e-06 >ref|XP_007013432.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508783795|gb|EOY31051.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 1885 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 231 MVSPKHLLLTIEFALLGPSPPTPRERIELMHAIRN 127 MVSPK LL TIE +LLGPSPPTP +R+EL+HAIR+ Sbjct: 1 MVSPKQLLSTIESSLLGPSPPTPAQRVELLHAIRS 35 >ref|XP_007203963.1| hypothetical protein PRUPE_ppa000100mg [Prunus persica] gi|462399494|gb|EMJ05162.1| hypothetical protein PRUPE_ppa000100mg [Prunus persica] Length = 1824 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 231 MVSPKHLLLTIEFALLGPSPPTPRERIELMHAIRN 127 MV PK LL T+E ALLGPSPP+P +R+ELMHAIRN Sbjct: 1 MVLPKQLLSTVESALLGPSPPSPSQRVELMHAIRN 35