BLASTX nr result
ID: Cocculus23_contig00018560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00018560 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36669.1| hypothetical protein MIMGU_mgv1a007664mg [Mimulus... 55 8e-06 >gb|EYU36669.1| hypothetical protein MIMGU_mgv1a007664mg [Mimulus guttatus] Length = 399 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/74 (39%), Positives = 42/74 (56%), Gaps = 2/74 (2%) Frame = +2 Query: 110 TYRLMEKVESKCEHFSVPEAPPLPRLRKTMWRRQSRSVSK--RDMWERLFDEGYRTDVSI 283 +Y L +K+ S H ++P+ PPLPR + + V K RD+WE+LF EGY DV + Sbjct: 35 SYFLEDKMPSPNNHHNIPKPPPLPRKKLNRGLPKHCFVPKETRDVWEKLFKEGYGADVHV 94 Query: 284 HTSDGHAIHAHACV 325 T +G I AH + Sbjct: 95 ITENGSIIPAHLSI 108