BLASTX nr result
ID: Cocculus23_contig00018447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00018447 (1659 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511750.1| calcium lipid binding protein, putative [Ric... 59 8e-06 >ref|XP_002511750.1| calcium lipid binding protein, putative [Ricinus communis] gi|223548930|gb|EEF50419.1| calcium lipid binding protein, putative [Ricinus communis] Length = 515 Score = 58.5 bits (140), Expect = 8e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 1560 LCLFNQPKPKIDYTLKAIGGSLTAVPGLSDMID 1658 + L ++PKPKIDY LKA+GGSLTA+PGLSDMID Sbjct: 195 IALLSEPKPKIDYVLKAVGGSLTAIPGLSDMID 227