BLASTX nr result
ID: Cocculus23_contig00018351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00018351 (226 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus tr... 62 1e-07 >ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus trichocarpa] gi|134093271|ref|YP_001109572.1| hypothetical protein Poptr_cp095 [Populus trichocarpa] gi|133712108|gb|ABO36751.1| conserved hypothetical protein [Populus trichocarpa] gi|133712133|gb|ABO36776.1| conserved hypothetical protein [Populus trichocarpa] Length = 61 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/33 (81%), Positives = 27/33 (81%) Frame = -1 Query: 226 ECWSISIGRSCHIGPSWTFNCFDLNYSEDTLYI 128 ECWSISI RSCHIGPS T NCFDLNY ED L I Sbjct: 8 ECWSISIDRSCHIGPSQTSNCFDLNYPEDALSI 40