BLASTX nr result
ID: Cocculus23_contig00018271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00018271 (544 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007141973.1| hypothetical protein PHAVU_008G241600g [Phas... 89 7e-16 ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago ... 87 2e-15 tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea m... 74 2e-11 gb|EPS67586.1| hypothetical protein M569_07192, partial [Genlise... 73 5e-11 gb|EMT14912.1| hypothetical protein F775_27789 [Aegilops tauschii] 69 7e-10 dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] 64 2e-08 ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833... 63 5e-08 ref|XP_003564165.1| PREDICTED: uncharacterized protein LOC100843... 60 3e-07 ref|XP_003573896.1| PREDICTED: uncharacterized protein LOC100840... 56 5e-06 >ref|XP_007141973.1| hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] gi|561015106|gb|ESW13967.1| hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] Length = 60 Score = 89.0 bits (219), Expect = 7e-16 Identities = 39/59 (66%), Positives = 51/59 (86%) Frame = -3 Query: 356 MKVFGKYIFPSHMVVAVSGLIFLASTTYDVHRCIKHNQTPPSREQVLALEDYIRSLRRS 180 M++FGK++FPS +++ SGL+F ASTTYDVHR IK+NQTPPS+EQ+ AL+DYI S RRS Sbjct: 1 MRIFGKHVFPSQIILFASGLLFFASTTYDVHRSIKNNQTPPSQEQLKALQDYIESARRS 59 >ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago truncatula] gi|355517481|gb|AES99104.1| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 119 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/60 (63%), Positives = 51/60 (85%) Frame = -3 Query: 356 MKVFGKYIFPSHMVVAVSGLIFLASTTYDVHRCIKHNQTPPSREQVLALEDYIRSLRRSP 177 M++FGK +FP +++ SGL+FLASTTYDVHR IK+N+TPPS EQ+ ALE+YI+S+RR P Sbjct: 1 MRIFGKPVFPRQIILFASGLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKSVRRQP 60 >tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea mays] Length = 750 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/55 (54%), Positives = 45/55 (81%) Frame = -3 Query: 356 MKVFGKYIFPSHMVVAVSGLIFLASTTYDVHRCIKHNQTPPSREQVLALEDYIRS 192 M++FGK++FP +V+ +G++F +TTYDVHR IK+N+ PP+REQ+ AL+DYI S Sbjct: 687 MRLFGKHVFPRQIVLFAAGMVFFGATTYDVHRSIKNNEQPPTREQMEALQDYINS 741 >gb|EPS67586.1| hypothetical protein M569_07192, partial [Genlisea aurea] Length = 58 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/58 (58%), Positives = 44/58 (75%) Frame = -3 Query: 356 MKVFGKYIFPSHMVVAVSGLIFLASTTYDVHRCIKHNQTPPSREQVLALEDYIRSLRR 183 MK+FGK I + V +G++F A+TTYDVHR IK+N+ PPS EQ+ ALEDYI S+RR Sbjct: 1 MKIFGKQISGRQIAVFSAGVLFFAATTYDVHRSIKNNEAPPSPEQIQALEDYIDSVRR 58 >gb|EMT14912.1| hypothetical protein F775_27789 [Aegilops tauschii] Length = 58 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/58 (50%), Positives = 43/58 (74%) Frame = -3 Query: 356 MKVFGKYIFPSHMVVAVSGLIFLASTTYDVHRCIKHNQTPPSREQVLALEDYIRSLRR 183 M+V G+++ P + + +GL+F +TTYDVHR IK+N PP+REQV AL+D+I S +R Sbjct: 1 MRVLGRHVSPRQIALLAAGLVFFGATTYDVHRSIKNNDQPPTREQVAALQDFIDSRKR 58 >dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 58 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/58 (46%), Positives = 42/58 (72%) Frame = -3 Query: 356 MKVFGKYIFPSHMVVAVSGLIFLASTTYDVHRCIKHNQTPPSREQVLALEDYIRSLRR 183 M++ G+++ P +V+ +GL+F +TTYDVHR IK+N PP+ EQV AL+ +I S +R Sbjct: 1 MRLLGRHVSPRQIVLLAAGLVFFGATTYDVHRSIKNNDQPPTSEQVAALQAFIDSRKR 58 >ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833743 [Brachypodium distachyon] Length = 58 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/58 (46%), Positives = 41/58 (70%) Frame = -3 Query: 356 MKVFGKYIFPSHMVVAVSGLIFLASTTYDVHRCIKHNQTPPSREQVLALEDYIRSLRR 183 M++ GK++ + + +GL+F +TTYDVHR IK+N PP+REQ+ AL+ YI S +R Sbjct: 1 MRLLGKHVSARQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQQYIDSKKR 58 >ref|XP_003564165.1| PREDICTED: uncharacterized protein LOC100843543 [Brachypodium distachyon] Length = 83 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 5/65 (7%) Frame = -3 Query: 356 MKVFGKYIFPSHMVVAVSGLIFLASTTYDVHRCIKHNQTPPSREQVLALEDY-----IRS 192 M+ GK++ P + + +GL+F +TTYDVHR IK+N PP+REQ+ AL+ Y +R+ Sbjct: 1 MRPLGKHVSPRQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQVYTTPRSVRT 60 Query: 191 LRRSP 177 R +P Sbjct: 61 NRSAP 65 >ref|XP_003573896.1| PREDICTED: uncharacterized protein LOC100840032 [Brachypodium distachyon] Length = 58 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/58 (43%), Positives = 38/58 (65%) Frame = -3 Query: 356 MKVFGKYIFPSHMVVAVSGLIFLASTTYDVHRCIKHNQTPPSREQVLALEDYIRSLRR 183 M+ K++ P + + +GL+ TTYDVHR IK+N P +REQ+ AL++YI S +R Sbjct: 1 MRPLDKHVSPRQVALFAAGLMLFGETTYDVHRSIKNNDQPSTREQMEALQEYIDSKKR 58