BLASTX nr result
ID: Cocculus23_contig00018134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00018134 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002885942.1| hypothetical protein ARALYDRAFT_480374 [Arab... 56 5e-06 ref|NP_179092.1| Mpv17/PMP22 family protein [Arabidopsis thalian... 55 8e-06 >ref|XP_002885942.1| hypothetical protein ARALYDRAFT_480374 [Arabidopsis lyrata subsp. lyrata] gi|297331782|gb|EFH62201.1| hypothetical protein ARALYDRAFT_480374 [Arabidopsis lyrata subsp. lyrata] Length = 248 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 182 VGWYLGMIKSHPVLTKSITCGGIYMAADVSSQ 277 VGWYLGM+KS PV+TKS+TC IY+AAD+SSQ Sbjct: 70 VGWYLGMVKSRPVVTKSVTCSLIYIAADLSSQ 101 >ref|NP_179092.1| Mpv17/PMP22 family protein [Arabidopsis thaliana] gi|3650028|gb|AAC61283.1| 22 kDa peroxisomal membrane protein [Arabidopsis thaliana] gi|124300964|gb|ABN04734.1| At2g14860 [Arabidopsis thaliana] gi|330251249|gb|AEC06343.1| Mpv17/PMP22 family protein [Arabidopsis thaliana] Length = 252 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 182 VGWYLGMIKSHPVLTKSITCGGIYMAADVSSQ 277 VGWYLGM+KSHPV+TKS+T IY+AAD+SSQ Sbjct: 74 VGWYLGMVKSHPVVTKSVTSSLIYIAADLSSQ 105