BLASTX nr result
ID: Cocculus23_contig00018066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00018066 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203786.1| hypothetical protein PRUPE_ppa001771mg [Prun... 57 3e-06 ref|XP_006381900.1| hypothetical protein POPTR_0006s20380g [Popu... 55 8e-06 >ref|XP_007203786.1| hypothetical protein PRUPE_ppa001771mg [Prunus persica] gi|462399317|gb|EMJ04985.1| hypothetical protein PRUPE_ppa001771mg [Prunus persica] Length = 767 Score = 57.0 bits (136), Expect = 3e-06 Identities = 38/80 (47%), Positives = 44/80 (55%), Gaps = 11/80 (13%) Frame = -1 Query: 207 GKNTREIPKSASKSGRKV-SGFVDSACKSAVNAFGYNYPVADDQEGGDDELKEGS----- 46 GKN KSASKSG KV SG + KS VNA GY YP + QEG L EG+ Sbjct: 60 GKNPSSNNKSASKSGAKVASGSKSESRKSNVNAIGYQYPSVERQEGLRPGLHEGNDVGKS 119 Query: 45 -----PIVLIQSKETQIVAY 1 P+VL+ K TQIVA+ Sbjct: 120 TDESCPLVLVDFKNTQIVAH 139 >ref|XP_006381900.1| hypothetical protein POPTR_0006s20380g [Populus trichocarpa] gi|550336716|gb|ERP59697.1| hypothetical protein POPTR_0006s20380g [Populus trichocarpa] Length = 461 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/72 (44%), Positives = 41/72 (56%), Gaps = 5/72 (6%) Frame = -1 Query: 201 NTREIPKSASK-----SGRKVSGFVDSACKSAVNAFGYNYPVADDQEGGDDELKEGSPIV 37 N + KS SK G+ SG ++ K++ NAF YNYP D QEG ++ PIV Sbjct: 66 NVKSNSKSGSKPGNSNQGKACSGSKNAPRKASGNAFVYNYPCFDLQEGTSRDMDVSQPIV 125 Query: 36 LIQSKETQIVAY 1 L+ SKET IVAY Sbjct: 126 LVDSKETHIVAY 137