BLASTX nr result
ID: Cocculus23_contig00017902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00017902 (222 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_201549.1| BTB and TAZ domain protein 4 [Arabidopsis thali... 57 4e-06 ref|NP_975007.1| BTB and TAZ domain protein 4 [Arabidopsis thali... 57 4e-06 gb|EYU36669.1| hypothetical protein MIMGU_mgv1a007664mg [Mimulus... 56 5e-06 >ref|NP_201549.1| BTB and TAZ domain protein 4 [Arabidopsis thaliana] gi|75262583|sp|Q9FJX5.1|BT4_ARATH RecName: Full=BTB/POZ and TAZ domain-containing protein 4; AltName: Full=BTB and TAZ domain protein 4 gi|17386120|gb|AAL38606.1|AF446873_1 AT5g67480/K9I9_4 [Arabidopsis thaliana] gi|9757869|dbj|BAB08456.1| unnamed protein product [Arabidopsis thaliana] gi|15529178|gb|AAK97683.1| AT5g67480/K9I9_4 [Arabidopsis thaliana] gi|36955915|gb|AAQ87007.1| BTB and TAZ domain protein 4 [Arabidopsis thaliana] gi|332010966|gb|AED98349.1| BTB and TAZ domain protein 4 [Arabidopsis thaliana] Length = 372 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 3/58 (5%) Frame = +1 Query: 52 SVPEAPPLPRLRKTMWRR---QSRSVSRRDMWERLFDEGYRTDVSIHTSDGHVIHAHA 216 SVP PPLP + ++ S S + RDMW+RLF++GY+ DV I+T +G +I+AHA Sbjct: 19 SVPIPPPLPSKSDGLKKKLGHSSVSTATRDMWDRLFNDGYKADVVIYTDNGSIIYAHA 76 >ref|NP_975007.1| BTB and TAZ domain protein 4 [Arabidopsis thaliana] gi|332010967|gb|AED98350.1| BTB and TAZ domain protein 4 [Arabidopsis thaliana] Length = 383 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 3/58 (5%) Frame = +1 Query: 52 SVPEAPPLPRLRKTMWRR---QSRSVSRRDMWERLFDEGYRTDVSIHTSDGHVIHAHA 216 SVP PPLP + ++ S S + RDMW+RLF++GY+ DV I+T +G +I+AHA Sbjct: 30 SVPIPPPLPSKSDGLKKKLGHSSVSTATRDMWDRLFNDGYKADVVIYTDNGSIIYAHA 87 >gb|EYU36669.1| hypothetical protein MIMGU_mgv1a007664mg [Mimulus guttatus] Length = 399 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/74 (37%), Positives = 43/74 (58%), Gaps = 2/74 (2%) Frame = +1 Query: 7 TYRLMEKVESKCEHFSVPEAPPLPR--LRKTMWRRQSRSVSRRDMWERLFDEGYRTDVSI 180 +Y L +K+ S H ++P+ PPLPR L + + + RD+WE+LF EGY DV + Sbjct: 35 SYFLEDKMPSPNNHHNIPKPPPLPRKKLNRGLPKHCFVPKETRDVWEKLFKEGYGADVHV 94 Query: 181 HTSDGHVIHAHACV 222 T +G +I AH + Sbjct: 95 ITENGSIIPAHLSI 108