BLASTX nr result
ID: Cocculus23_contig00014960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00014960 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30518.1| hypothetical protein MIMGU_mgv1a0020011mg, partia... 55 8e-06 >gb|EYU30518.1| hypothetical protein MIMGU_mgv1a0020011mg, partial [Mimulus guttatus] Length = 275 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 160 MVARKLLVQHKHSQFDLDYDTDDGLEVLKFQLF 258 MVARK +V H S FDLDYDTDDG EVLKFQLF Sbjct: 1 MVARKFVVHHGGSAFDLDYDTDDGFEVLKFQLF 33