BLASTX nr result
ID: Cocculus23_contig00014870
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00014870 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313733.1| hypothetical protein POPTR_0009s13300g [Popu... 57 3e-06 >ref|XP_002313733.1| hypothetical protein POPTR_0009s13300g [Populus trichocarpa] gi|222850141|gb|EEE87688.1| hypothetical protein POPTR_0009s13300g [Populus trichocarpa] Length = 527 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 156 ESTISEIQQAFSETKLTSRQLVDFYLKQIKKLNPTL 263 ESTI EIQQAF+E KLTS QLVDFY+ QIK LNP L Sbjct: 33 ESTIEEIQQAFAENKLTSTQLVDFYITQIKTLNPLL 68