BLASTX nr result
ID: Cocculus23_contig00014739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00014739 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006357275.1| PREDICTED: LOW QUALITY PROTEIN: two-componen... 53 1e-10 ref|XP_004238726.1| PREDICTED: LOW QUALITY PROTEIN: two-componen... 53 1e-10 ref|XP_006417463.1| hypothetical protein EUTSA_v10008575mg [Eutr... 52 3e-10 ref|NP_176202.1| response regulator 3 [Arabidopsis thaliana] gi|... 52 3e-10 dbj|BAL43556.1| type-A response regulator [Petunia x hybrida] 51 4e-10 ref|XP_002886648.1| predicted protein [Arabidopsis lyrata subsp.... 52 5e-10 gb|ABQ95670.1| type A response regulator, partial [Malus domestica] 51 7e-10 gb|EPS59237.1| hypothetical protein M569_15571, partial [Genlise... 53 7e-10 ref|XP_007208910.1| hypothetical protein PRUPE_ppa027113mg, part... 49 3e-09 ref|XP_002892573.1| hypothetical protein ARALYDRAFT_888316 [Arab... 49 3e-09 ref|NP_172517.1| two-component response regulator ARR4 [Arabidop... 48 4e-09 gb|EPS61460.1| hypothetical protein M569_13338, partial [Genlise... 52 8e-09 ref|XP_003565091.1| PREDICTED: two-component response regulator ... 49 2e-08 ref|XP_002513063.1| Two-component response regulator ARR8, putat... 48 2e-08 ref|XP_006304102.1| hypothetical protein CARUB_v10010030mg [Caps... 48 2e-08 ref|XP_007011051.1| Two-component response regulator ARR8 [Theob... 46 3e-08 ref|XP_003627814.1| Two-component response regulator ARR8 [Medic... 47 3e-08 ref|XP_004233018.1| PREDICTED: two-component response regulator ... 49 3e-08 ref|XP_006355595.1| PREDICTED: two-component response regulator ... 49 3e-08 ref|NP_001045420.1| Os01g0952500 [Oryza sativa Japonica Group] g... 47 4e-08 >ref|XP_006357275.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator ARR4-like [Solanum tuberosum] Length = 263 Score = 52.8 bits (125), Expect(2) = 1e-10 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMRE 3 I RCLEEGAE+FL+KPVKL+DVKRLK Y+ E Sbjct: 145 IDRCLEEGAEDFLLKPVKLADVKRLKSYMFNE 176 Score = 38.5 bits (88), Expect(2) = 1e-10 Identities = 18/24 (75%), Positives = 22/24 (91%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S+F+E+PVVIMSSENVL RI+R L Sbjct: 126 SSFREVPVVIMSSENVLARIDRCL 149 >ref|XP_004238726.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator ARR4-like [Solanum lycopersicum] Length = 248 Score = 52.8 bits (125), Expect(2) = 1e-10 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMRE 3 I RCLEEGAE+FL+KPVKL+DVKRLK Y+ E Sbjct: 127 IDRCLEEGAEDFLLKPVKLADVKRLKSYMFNE 158 Score = 38.5 bits (88), Expect(2) = 1e-10 Identities = 18/24 (75%), Positives = 22/24 (91%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S+F+E+PVVIMSSENVL RI+R L Sbjct: 108 SSFREVPVVIMSSENVLARIDRCL 131 >ref|XP_006417463.1| hypothetical protein EUTSA_v10008575mg [Eutrema salsugineum] gi|557095234|gb|ESQ35816.1| hypothetical protein EUTSA_v10008575mg [Eutrema salsugineum] Length = 250 Score = 51.6 bits (122), Expect(2) = 3e-10 Identities = 22/32 (68%), Positives = 30/32 (93%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMRE 3 I RCLEEGAE+FL+KPVKL+DVKRL++Y+ ++ Sbjct: 129 IDRCLEEGAEDFLLKPVKLADVKRLRNYLTKD 160 Score = 38.5 bits (88), Expect(2) = 3e-10 Identities = 18/24 (75%), Positives = 22/24 (91%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S+F+E+PVVIMSSENVL RI+R L Sbjct: 110 SSFREVPVVIMSSENVLTRIDRCL 133 >ref|NP_176202.1| response regulator 3 [Arabidopsis thaliana] gi|51316126|sp|Q9ZWS9.1|ARR3_ARATH RecName: Full=Two-component response regulator ARR3 gi|5080824|gb|AAD39333.1|AC007258_22 response regulator 3 [Arabidopsis thaliana] gi|3953595|dbj|BAA34725.1| response regulator 3 [Arabidopsis thaliana] gi|89111918|gb|ABD60731.1| At1g59940 [Arabidopsis thaliana] gi|110737841|dbj|BAF00859.1| hypothetical protein [Arabidopsis thaliana] gi|332195521|gb|AEE33642.1| response regulator 3 [Arabidopsis thaliana] Length = 231 Score = 52.4 bits (124), Expect(2) = 3e-10 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMRE 3 I RCLEEGAE+FL+KPVKL+DVKRL+ Y+ R+ Sbjct: 132 IDRCLEEGAEDFLLKPVKLADVKRLRSYLTRD 163 Score = 37.7 bits (86), Expect(2) = 3e-10 Identities = 17/24 (70%), Positives = 22/24 (91%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 ++FKE+PVVIMSSENV+ RI+R L Sbjct: 113 TSFKEVPVVIMSSENVMTRIDRCL 136 >dbj|BAL43556.1| type-A response regulator [Petunia x hybrida] Length = 258 Score = 50.8 bits (120), Expect(2) = 4e-10 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMRE 3 I RCLEEGAE+FL+KPVKL+DVKRLK ++ E Sbjct: 123 IDRCLEEGAEDFLLKPVKLADVKRLKSFMFSE 154 Score = 38.9 bits (89), Expect(2) = 4e-10 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S+F+EIPVVIMSSENVL RI+R L Sbjct: 104 SSFREIPVVIMSSENVLTRIDRCL 127 >ref|XP_002886648.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297332489|gb|EFH62907.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 229 Score = 51.6 bits (122), Expect(2) = 5e-10 Identities = 22/32 (68%), Positives = 30/32 (93%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMRE 3 I RCLEEGAE+FL+KPVKL+DVKRL++Y+ ++ Sbjct: 132 IDRCLEEGAEDFLLKPVKLADVKRLRNYLTKD 163 Score = 37.7 bits (86), Expect(2) = 5e-10 Identities = 17/24 (70%), Positives = 22/24 (91%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 ++FKE+PVVIMSSENV+ RI+R L Sbjct: 113 TSFKEVPVVIMSSENVITRIDRCL 136 >gb|ABQ95670.1| type A response regulator, partial [Malus domestica] Length = 194 Score = 51.2 bits (121), Expect(2) = 7e-10 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIM 9 I RCLEEGAEE++VKPVKLSDV RLK+++M Sbjct: 99 IDRCLEEGAEEYIVKPVKLSDVNRLKNFMM 128 Score = 37.7 bits (86), Expect(2) = 7e-10 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S F+E+PVVIMSSEN+L RI+R L Sbjct: 80 SAFREVPVVIMSSENILTRIDRCL 103 >gb|EPS59237.1| hypothetical protein M569_15571, partial [Genlisea aurea] Length = 135 Score = 53.1 bits (126), Expect(2) = 7e-10 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMR 6 I RCLEEGAEE+LVKPVKLSDV+RL+++++R Sbjct: 105 IDRCLEEGAEEYLVKPVKLSDVERLREFVLR 135 Score = 35.8 bits (81), Expect(2) = 7e-10 Identities = 16/21 (76%), Positives = 20/21 (95%) Frame = -1 Query: 247 KEIPVVIMSSENVLPRINRYL 185 +EIPVVIMSSEN+LP+I+R L Sbjct: 89 REIPVVIMSSENILPQIDRCL 109 >ref|XP_007208910.1| hypothetical protein PRUPE_ppa027113mg, partial [Prunus persica] gi|462404645|gb|EMJ10109.1| hypothetical protein PRUPE_ppa027113mg, partial [Prunus persica] Length = 164 Score = 49.3 bits (116), Expect(2) = 3e-09 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIM 9 I RCLEEGAEE+++KPVKLSDV RLK ++M Sbjct: 128 IDRCLEEGAEEYILKPVKLSDVNRLKHFMM 157 Score = 37.7 bits (86), Expect(2) = 3e-09 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S F+E+PVVIMSSEN+L RI+R L Sbjct: 109 SAFREVPVVIMSSENILTRIDRCL 132 >ref|XP_002892573.1| hypothetical protein ARALYDRAFT_888316 [Arabidopsis lyrata subsp. lyrata] gi|297338415|gb|EFH68832.1| hypothetical protein ARALYDRAFT_888316 [Arabidopsis lyrata subsp. lyrata] Length = 258 Score = 48.5 bits (114), Expect(2) = 3e-09 Identities = 20/32 (62%), Positives = 30/32 (93%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMRE 3 I RCLEEGA++FL+KPVKL+DVKRL++++ ++ Sbjct: 130 IDRCLEEGAQDFLLKPVKLADVKRLRNHLTKD 161 Score = 38.1 bits (87), Expect(2) = 3e-09 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S F+E+PVVIMSSENVL RI+R L Sbjct: 111 SNFREVPVVIMSSENVLTRIDRCL 134 >ref|NP_172517.1| two-component response regulator ARR4 [Arabidopsis thaliana] gi|51315817|sp|O82798.1|ARR4_ARATH RecName: Full=Two-component response regulator ARR4; AltName: Full=Response regulator 1 gi|5091539|gb|AAD39568.1|AC007067_8 T10O24.8 [Arabidopsis thaliana] gi|3273196|dbj|BAA31143.1| responce regulator1 [Arabidopsis thaliana] gi|3323583|gb|AAC26636.1| two-component response regulator homolog [Arabidopsis thaliana] gi|3953597|dbj|BAA34726.1| response regulator 4 [Arabidopsis thaliana] gi|87116590|gb|ABD19659.1| At1g10470 [Arabidopsis thaliana] gi|110740750|dbj|BAE98474.1| putative response regulator 3 [Arabidopsis thaliana] gi|332190462|gb|AEE28583.1| two-component response regulator ARR4 [Arabidopsis thaliana] Length = 259 Score = 48.1 bits (113), Expect(2) = 4e-09 Identities = 20/32 (62%), Positives = 29/32 (90%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMRE 3 I RCLEEGA++FL+KPVKL+DVKRL+ ++ ++ Sbjct: 133 IDRCLEEGAQDFLLKPVKLADVKRLRSHLTKD 164 Score = 38.1 bits (87), Expect(2) = 4e-09 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S F+E+PVVIMSSENVL RI+R L Sbjct: 114 SNFREVPVVIMSSENVLTRIDRCL 137 >gb|EPS61460.1| hypothetical protein M569_13338, partial [Genlisea aurea] Length = 65 Score = 52.4 bits (124), Expect(2) = 8e-09 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMR 6 + RCLEEGAEEFL+KPV+LSDVK+LK +IM+ Sbjct: 24 VNRCLEEGAEEFLLKPVRLSDVKKLKPHIMK 54 Score = 33.1 bits (74), Expect(2) = 8e-09 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S ++IPVVIMSSENV R+NR L Sbjct: 5 SYLRDIPVVIMSSENVPSRVNRCL 28 >ref|XP_003565091.1| PREDICTED: two-component response regulator ARR9-like [Brachypodium distachyon] Length = 213 Score = 48.5 bits (114), Expect(2) = 2e-08 Identities = 20/31 (64%), Positives = 28/31 (90%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMR 6 I RCLE+GAEEF +KPVKL+D+K+LK +++R Sbjct: 121 INRCLEDGAEEFFLKPVKLADMKKLKSHLLR 151 Score = 35.8 bits (81), Expect(2) = 2e-08 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S+ K+IPVVIMSSENV RINR L Sbjct: 102 SSLKDIPVVIMSSENVPARINRCL 125 >ref|XP_002513063.1| Two-component response regulator ARR8, putative [Ricinus communis] gi|223548074|gb|EEF49566.1| Two-component response regulator ARR8, putative [Ricinus communis] Length = 197 Score = 47.8 bits (112), Expect(2) = 2e-08 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMR 6 I RCLEEGAEEF +KPV+LSDV +LK ++M+ Sbjct: 127 INRCLEEGAEEFFLKPVQLSDVNKLKPHMMK 157 Score = 36.6 bits (83), Expect(2) = 2e-08 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -1 Query: 253 TFKEIPVVIMSSENVLPRINRYL 185 +FK+IPVVIMSSENV RINR L Sbjct: 109 SFKDIPVVIMSSENVPSRINRCL 131 >ref|XP_006304102.1| hypothetical protein CARUB_v10010030mg [Capsella rubella] gi|482572813|gb|EOA37000.1| hypothetical protein CARUB_v10010030mg [Capsella rubella] Length = 265 Score = 48.1 bits (113), Expect(2) = 2e-08 Identities = 20/32 (62%), Positives = 29/32 (90%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMRE 3 I RCLEEGA++FL+KPVKL+DVKRL+ ++ ++ Sbjct: 138 IDRCLEEGAQDFLLKPVKLADVKRLRSHLSKD 169 Score = 35.8 bits (81), Expect(2) = 2e-08 Identities = 16/24 (66%), Positives = 21/24 (87%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S F+++PVVIMSSENV+ RI+R L Sbjct: 119 SNFRQVPVVIMSSENVVTRIDRCL 142 >ref|XP_007011051.1| Two-component response regulator ARR8 [Theobroma cacao] gi|508727964|gb|EOY19861.1| Two-component response regulator ARR8 [Theobroma cacao] Length = 188 Score = 45.8 bits (107), Expect(2) = 3e-08 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMR 6 I RCLE+GAEEF +KPV+LSDV +L+ ++M+ Sbjct: 123 INRCLEDGAEEFFLKPVQLSDVNKLRPHLMK 153 Score = 37.7 bits (86), Expect(2) = 3e-08 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S+FK+IPVVIMSSEN+ RINR L Sbjct: 104 SSFKDIPVVIMSSENIPSRINRCL 127 >ref|XP_003627814.1| Two-component response regulator ARR8 [Medicago truncatula] gi|92885116|gb|ABE87636.1| Response regulator receiver [Medicago truncatula] gi|355521836|gb|AET02290.1| Two-component response regulator ARR8 [Medicago truncatula] gi|388516389|gb|AFK46256.1| unknown [Medicago truncatula] Length = 177 Score = 47.0 bits (110), Expect(2) = 3e-08 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMR 6 I RCLEEGAEEF +KPV+LSDV +LK ++++ Sbjct: 116 INRCLEEGAEEFFLKPVQLSDVSKLKPHLLK 146 Score = 36.6 bits (83), Expect(2) = 3e-08 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -1 Query: 253 TFKEIPVVIMSSENVLPRINRYL 185 +FK+IPVVIMSSENV RINR L Sbjct: 98 SFKDIPVVIMSSENVPSRINRCL 120 >ref|XP_004233018.1| PREDICTED: two-component response regulator ARR9-like [Solanum lycopersicum] Length = 166 Score = 49.3 bits (116), Expect(2) = 3e-08 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMRE 3 I RCLEEGAEEF +KPV+ SDV R+K ++MRE Sbjct: 95 INRCLEEGAEEFFLKPVQQSDVNRIKPHLMRE 126 Score = 34.3 bits (77), Expect(2) = 3e-08 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S K+IPV+IMSSENV RINR L Sbjct: 76 SYLKDIPVIIMSSENVPSRINRCL 99 >ref|XP_006355595.1| PREDICTED: two-component response regulator ARR9-like [Solanum tuberosum] Length = 163 Score = 49.3 bits (116), Expect(2) = 3e-08 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMRE 3 I RCLEEGAEEF +KPV+ SDV R+K ++MRE Sbjct: 95 INRCLEEGAEEFFLKPVQQSDVNRIKPHLMRE 126 Score = 34.3 bits (77), Expect(2) = 3e-08 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S K+IPV+IMSSENV RINR L Sbjct: 76 SYLKDIPVIIMSSENVPSRINRCL 99 >ref|NP_001045420.1| Os01g0952500 [Oryza sativa Japonica Group] gi|15528802|dbj|BAB64697.1| putative response regulator [Oryza sativa Japonica Group] gi|71273481|emb|CAI79408.1| Type A response regulator 4 [Oryza sativa Indica Group] gi|87116386|dbj|BAE79352.1| typeA response regulator 4 [Oryza sativa Japonica Group] gi|113534951|dbj|BAF07334.1| Os01g0952500 [Oryza sativa Japonica Group] gi|118790806|tpd|FAA00262.1| TPA: A-type response regulator [Oryza sativa Japonica Group] gi|125529138|gb|EAY77252.1| hypothetical protein OsI_05226 [Oryza sativa Indica Group] gi|125573340|gb|EAZ14855.1| hypothetical protein OsJ_04783 [Oryza sativa Japonica Group] gi|215678767|dbj|BAG95204.1| unnamed protein product [Oryza sativa Japonica Group] Length = 232 Score = 47.4 bits (111), Expect(2) = 4e-08 Identities = 19/31 (61%), Positives = 28/31 (90%) Frame = -3 Query: 98 IYRCLEEGAEEFLVKPVKLSDVKRLKDYIMR 6 I RCLE+GAEEF +KPVKL+D+K+LK ++++ Sbjct: 118 INRCLEDGAEEFFLKPVKLADMKKLKSHLLK 148 Score = 35.8 bits (81), Expect(2) = 4e-08 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -1 Query: 256 STFKEIPVVIMSSENVLPRINRYL 185 S+ K+IPVVIMSSENV RINR L Sbjct: 99 SSLKDIPVVIMSSENVPARINRCL 122