BLASTX nr result
ID: Cocculus23_contig00014622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00014622 (549 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF05806.1| PAE [Litchi chinensis] 67 3e-09 ref|XP_002519911.1| pectin acetylesterase, putative [Ricinus com... 67 4e-09 gb|ADR82372.1| pectin acetylesterase [Populus trichocarpa] 66 5e-09 ref|XP_006385133.1| pectinacetylesterase family protein [Populus... 66 5e-09 ref|XP_004246220.1| PREDICTED: uncharacterized protein LOC101249... 64 3e-08 gb|EXC31044.1| hypothetical protein L484_021346 [Morus notabilis] 63 4e-08 ref|NP_199341.1| pectinacetylesterase family protein [Arabidopsi... 63 4e-08 ref|XP_006471634.1| PREDICTED: uncharacterized protein LOC102628... 63 4e-08 ref|XP_006432878.1| hypothetical protein CICLE_v100013712mg, par... 63 4e-08 ref|XP_006280604.1| hypothetical protein CARUB_v10026563mg [Caps... 63 4e-08 ref|XP_004246040.1| PREDICTED: protein notum homolog [Solanum ly... 63 4e-08 ref|XP_002865253.1| pectin acetylesterase [Arabidopsis lyrata su... 63 4e-08 gb|AAM65412.1| pectin acetylesterase [Arabidopsis thaliana] 63 4e-08 ref|NP_851135.1| pectinacetylesterase family protein [Arabidopsi... 63 4e-08 ref|XP_006398195.1| hypothetical protein EUTSA_v10000914mg [Eutr... 63 5e-08 ref|NP_001047850.1| Os02g0702400 [Oryza sativa Japonica Group] g... 63 5e-08 gb|ABR16604.1| unknown [Picea sitchensis] 63 5e-08 ref|XP_006413980.1| hypothetical protein EUTSA_v10025385mg [Eutr... 62 7e-08 ref|XP_006878664.1| hypothetical protein AMTR_s00011p00266820 [A... 62 7e-08 ref|XP_006282674.1| hypothetical protein CARUB_v10005284mg [Caps... 62 7e-08 >gb|ACF05806.1| PAE [Litchi chinensis] Length = 399 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAKNLPA+CTSR+ P LCFFPQYM + IQTPLF++N Sbjct: 230 GSAKNLPASCTSRLKPGLCFFPQYMARQIQTPLFIIN 266 >ref|XP_002519911.1| pectin acetylesterase, putative [Ricinus communis] gi|223540957|gb|EEF42515.1| pectin acetylesterase, putative [Ricinus communis] Length = 399 Score = 66.6 bits (161), Expect = 4e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAKNLP +CTSR+ P+LCFFPQY+VQ I+TPLF+LN Sbjct: 230 GSAKNLPLSCTSRLKPALCFFPQYLVQQIRTPLFILN 266 >gb|ADR82372.1| pectin acetylesterase [Populus trichocarpa] Length = 394 Score = 66.2 bits (160), Expect = 5e-09 Identities = 26/37 (70%), Positives = 35/37 (94%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAKNLPA+CTS+++P LCFFPQY+ QT++TPLF++N Sbjct: 230 GSAKNLPASCTSKMNPELCFFPQYVAQTMRTPLFIIN 266 >ref|XP_006385133.1| pectinacetylesterase family protein [Populus trichocarpa] gi|550341901|gb|ERP62930.1| pectinacetylesterase family protein [Populus trichocarpa] Length = 394 Score = 66.2 bits (160), Expect = 5e-09 Identities = 26/37 (70%), Positives = 35/37 (94%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAKNLPA+CTS+++P LCFFPQY+ QT++TPLF++N Sbjct: 230 GSAKNLPASCTSKMNPELCFFPQYVAQTMRTPLFIIN 266 >ref|XP_004246220.1| PREDICTED: uncharacterized protein LOC101249672 [Solanum lycopersicum] Length = 645 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAKNLP+ACTS ++PSLCFFPQ MV +QTPLF++N Sbjct: 484 GSAKNLPSACTSVMEPSLCFFPQNMVSYVQTPLFIIN 520 >gb|EXC31044.1| hypothetical protein L484_021346 [Morus notabilis] Length = 386 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAKNLP++CTSR+ P LCFFPQY+V IQTP+F +N Sbjct: 218 GSAKNLPSSCTSRLSPGLCFFPQYVVSQIQTPIFFVN 254 >ref|NP_199341.1| pectinacetylesterase family protein [Arabidopsis thaliana] gi|10176999|dbj|BAB10249.1| pectin acetylesterase [Arabidopsis thaliana] gi|16323123|gb|AAL15296.1| AT5g45280/K9E15_6 [Arabidopsis thaliana] gi|332007843|gb|AED95226.1| pectinacetylesterase family protein [Arabidopsis thaliana] Length = 391 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAK+LPA+CTS + P LCFFPQY+ +T+QTPLFV+N Sbjct: 227 GSAKSLPASCTSSMKPDLCFFPQYVAKTLQTPLFVIN 263 >ref|XP_006471634.1| PREDICTED: uncharacterized protein LOC102628021 [Citrus sinensis] Length = 399 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAK+LPA+CTSR+ P LCFFPQYM + I TPLF++N Sbjct: 230 GSAKHLPASCTSRLSPGLCFFPQYMARQITTPLFIIN 266 >ref|XP_006432878.1| hypothetical protein CICLE_v100013712mg, partial [Citrus clementina] gi|557535000|gb|ESR46118.1| hypothetical protein CICLE_v100013712mg, partial [Citrus clementina] Length = 276 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAK+LPA+CTSR+ P LCFFPQYM + I TPLF++N Sbjct: 230 GSAKHLPASCTSRLSPGLCFFPQYMARQITTPLFIIN 266 >ref|XP_006280604.1| hypothetical protein CARUB_v10026563mg [Capsella rubella] gi|482549308|gb|EOA13502.1| hypothetical protein CARUB_v10026563mg [Capsella rubella] Length = 391 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAK+LPA+CTS + P LCFFPQY+ +T+QTPLFV+N Sbjct: 227 GSAKSLPASCTSTMKPELCFFPQYVAKTLQTPLFVIN 263 >ref|XP_004246040.1| PREDICTED: protein notum homolog [Solanum lycopersicum] Length = 400 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAKNLP+ACTS ++PSLCFFPQ +V IQTPLF++N Sbjct: 244 GSAKNLPSACTSAMEPSLCFFPQNVVSYIQTPLFIIN 280 >ref|XP_002865253.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata] gi|297311088|gb|EFH41512.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata] Length = 391 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAK+LP +CTS + P LCFFPQY+ QT+QTPLFV+N Sbjct: 227 GSAKSLPVSCTSSMKPELCFFPQYVAQTLQTPLFVIN 263 >gb|AAM65412.1| pectin acetylesterase [Arabidopsis thaliana] Length = 391 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAK+LPA+CTS + P LCFFPQY+ +T+QTPLFV+N Sbjct: 227 GSAKSLPASCTSSMKPELCFFPQYVAKTLQTPLFVIN 263 >ref|NP_851135.1| pectinacetylesterase family protein [Arabidopsis thaliana] gi|15810319|gb|AAL07047.1| putative pectin acetylesterase [Arabidopsis thaliana] gi|23297554|gb|AAN12894.1| putative pectin acetylesterase [Arabidopsis thaliana] gi|332007842|gb|AED95225.1| pectinacetylesterase family protein [Arabidopsis thaliana] Length = 370 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAK+LPA+CTS + P LCFFPQY+ +T+QTPLFV+N Sbjct: 227 GSAKSLPASCTSSMKPDLCFFPQYVAKTLQTPLFVIN 263 >ref|XP_006398195.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum] gi|557099284|gb|ESQ39648.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum] Length = 391 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAK+LP +CTS + P LCFFPQY+V+T+QTPLFV+N Sbjct: 227 GSAKSLPVSCTSSMKPELCFFPQYVVKTMQTPLFVIN 263 >ref|NP_001047850.1| Os02g0702400 [Oryza sativa Japonica Group] gi|41052692|dbj|BAD07550.1| putative pectin acetylesterase [Oryza sativa Japonica Group] gi|41053116|dbj|BAD08059.1| putative pectin acetylesterase [Oryza sativa Japonica Group] gi|113537381|dbj|BAF09764.1| Os02g0702400 [Oryza sativa Japonica Group] gi|215697024|dbj|BAG91018.1| unnamed protein product [Oryza sativa Japonica Group] gi|222623505|gb|EEE57637.1| hypothetical protein OsJ_08062 [Oryza sativa Japonica Group] Length = 397 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAKNLP+ACTSR+ P +CFFPQ V+ IQTPLF+LN Sbjct: 230 GSAKNLPSACTSRLSPGMCFFPQNEVKQIQTPLFILN 266 >gb|ABR16604.1| unknown [Picea sitchensis] Length = 434 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 G AKNLP ACTSR+DP+ CFFPQ+++Q I+TPLF+LN Sbjct: 271 GVAKNLPRACTSRMDPAQCFFPQHLLQDIKTPLFILN 307 >ref|XP_006413980.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum] gi|557115150|gb|ESQ55433.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum] Length = 397 Score = 62.4 bits (150), Expect = 7e-08 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAKNLP +CTSR+ P++CFFPQY+ + I+TPLF+LN Sbjct: 228 GSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPLFILN 264 >ref|XP_006878664.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda] gi|548832007|gb|ERM94809.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda] Length = 398 Score = 62.4 bits (150), Expect = 7e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +2 Query: 440 SAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 SAKNLP +CTSR+ PSLCFFPQYM Q I+TP F+LN Sbjct: 230 SAKNLPQSCTSRLKPSLCFFPQYMAQGIRTPFFLLN 265 >ref|XP_006282674.1| hypothetical protein CARUB_v10005284mg [Capsella rubella] gi|482551379|gb|EOA15572.1| hypothetical protein CARUB_v10005284mg [Capsella rubella] Length = 317 Score = 62.4 bits (150), Expect = 7e-08 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +2 Query: 437 GSAKNLPAACTSRVDPSLCFFPQYMVQTIQTPLFVLN 547 GSAKNLP +CTSR+ P++CFFPQY+ + I+TPLF+LN Sbjct: 148 GSAKNLPRSCTSRLTPAMCFFPQYVAREIRTPLFILN 184