BLASTX nr result
ID: Cocculus23_contig00013285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00013285 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCT65955.1| probable RPL39-60S large subunit ribosomal prote... 108 6e-22 gb|EMF12058.1| ribosomal protein L39e [Sphaerulina musiva SO2202] 108 8e-22 ref|XP_002848813.1| hypothetical protein MCYG_01747 [Arthroderma... 108 1e-21 gb|EPS27305.1| hypothetical protein PDE_02248 [Penicillium oxali... 107 1e-21 gb|EHK48913.1| hypothetical protein TRIATDRAFT_254996 [Trichoder... 107 2e-21 ref|XP_003850033.1| 60S ribosomal protein L39 [Zymoseptoria trit... 107 2e-21 ref|XP_001908102.1| hypothetical protein [Podospora anserina S m... 107 2e-21 ref|XP_003051759.1| 60S ribosomal protein L39 [Nectria haematoco... 106 3e-21 gb|EMC96913.1| hypothetical protein BAUCODRAFT_147112 [Baudoinia... 106 4e-21 ref|XP_001542836.1| 60S ribosomal protein L39 [Ajellomyces capsu... 106 4e-21 gb|EME43136.1| hypothetical protein DOTSEDRAFT_173805 [Dothistro... 105 5e-21 ref|XP_003655482.1| 60S ribosomal protein L39 [Thielavia terrest... 105 6e-21 emb|CCF37051.1| 60S ribosomal protein L39 [Colletotrichum higgin... 105 8e-21 ref|XP_003189071.1| 60S ribosomal protein L39 [Aspergillus oryza... 105 8e-21 ref|XP_002544670.1| predicted protein [Uncinocarpus reesii 1704]... 105 8e-21 ref|XP_002482271.1| ribosomal protein L39e, putative [Talaromyce... 105 8e-21 ref|XP_959018.2| 60S ribosomal protein L39 [Neurospora crassa OR... 105 8e-21 ref|XP_001229558.1| 60S ribosomal protein L39 [Chaetomium globos... 104 1e-20 emb|CCU76647.1| 60S ribosomal protein L39 [Blumeria graminis f. ... 104 1e-20 ref|XP_006961218.1| ribosomal protein L39e [Trichoderma reesei Q... 104 1e-20 >emb|CCT65955.1| probable RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi IMI 58289] Length = 93 Score = 108 bits (271), Expect = 6e-22 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +1 Query: 76 SAKMPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 + KMPSHK+FRTKQKLAKAQK NRP+PQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 40 AVKMPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 93 >gb|EMF12058.1| ribosomal protein L39e [Sphaerulina musiva SO2202] Length = 51 Score = 108 bits (270), Expect = 8e-22 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHKTFRTKQKLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >ref|XP_002848813.1| hypothetical protein MCYG_01747 [Arthroderma otae CBS 113480] gi|238839266|gb|EEQ28928.1| hypothetical protein MCYG_01747 [Arthroderma otae CBS 113480] Length = 94 Score = 108 bits (269), Expect = 1e-21 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +1 Query: 64 DVATSAKMPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 D + S KMPS K+FRTKQKLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 37 DSSESVKMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 94 >gb|EPS27305.1| hypothetical protein PDE_02248 [Penicillium oxalicum 114-2] Length = 51 Score = 107 bits (268), Expect = 1e-21 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHKTFRTKQKLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|EHK48913.1| hypothetical protein TRIATDRAFT_254996 [Trichoderma atroviride IMI 206040] Length = 51 Score = 107 bits (267), Expect = 2e-21 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHKTFRTKQKLAKAQK NRP+PQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSHKTFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >ref|XP_003850033.1| 60S ribosomal protein L39 [Zymoseptoria tritici IPO323] gi|339469911|gb|EGP85009.1| hypothetical protein MYCGRDRAFT_105463 [Zymoseptoria tritici IPO323] gi|494829312|gb|EON66003.1| 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] Length = 51 Score = 107 bits (266), Expect = 2e-21 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHK+FRTKQKLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >ref|XP_001908102.1| hypothetical protein [Podospora anserina S mat+] gi|170943122|emb|CAP68775.1| unnamed protein product [Podospora anserina S mat+] Length = 51 Score = 107 bits (266), Expect = 2e-21 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHKTFRTKQKLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTR+G+ Sbjct: 1 MPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGL 51 >ref|XP_003051759.1| 60S ribosomal protein L39 [Nectria haematococca mpVI 77-13-4] gi|256732698|gb|EEU46046.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|342865967|gb|EGU71968.1| hypothetical protein FOXB_17529 [Fusarium oxysporum Fo5176] gi|408388242|gb|EKJ67928.1| hypothetical protein FPSE_11739 [Fusarium pseudograminearum CS3096] gi|558862998|gb|ESU13081.1| hypothetical protein FGSG_06921 [Fusarium graminearum PH-1] gi|584139211|gb|EWG48551.1| 60S ribosomal protein L39 [Fusarium verticillioides 7600] gi|587676271|gb|EWY98599.1| 60S ribosomal protein L39 [Fusarium oxysporum FOSC 3-a] gi|587698070|gb|EWZ44675.1| 60S ribosomal protein L39 [Fusarium oxysporum Fo47] gi|587727111|gb|EWZ98448.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587752242|gb|EXA49958.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. pisi HDV247] gi|590040183|gb|EXK42041.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. melonis 26406] gi|590073088|gb|EXL00613.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. raphani 54005] gi|591426865|gb|EXL62002.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591453858|gb|EXL86129.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591463667|gb|EXL95148.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591507348|gb|EXM36611.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596543402|gb|EYB23707.1| hypothetical protein FG05_06921 [Fusarium graminearum] Length = 51 Score = 106 bits (265), Expect = 3e-21 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHK+FRTKQKLAKAQK NRP+PQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >gb|EMC96913.1| hypothetical protein BAUCODRAFT_147112 [Baudoinia compniacensis UAMH 10762] Length = 51 Score = 106 bits (264), Expect = 4e-21 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHK+FRTKQKLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTRIG+ Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGL 51 >ref|XP_001542836.1| 60S ribosomal protein L39 [Ajellomyces capsulatus NAm1] gi|327292414|ref|XP_003230906.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 118892] gi|389629646|ref|XP_003712476.1| 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] gi|615467304|ref|XP_007599880.1| hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] gi|150411016|gb|EDN06404.1| ribosomal protein L39 [Ajellomyces capsulatus NAm1] gi|259487695|tpe|CBF86564.1| TPA: conserved hypothetical protein [Aspergillus nidulans FGSC A4] gi|326466942|gb|EGD92395.1| ribosomal L39 protein [Trichophyton rubrum CBS 118892] gi|351644808|gb|EHA52669.1| 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] gi|402083766|gb|EJT78784.1| 60S ribosomal protein L39 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|440475962|gb|ELQ44608.1| hypothetical protein OOU_Y34scaffold00071g24 [Magnaporthe oryzae Y34] gi|440487781|gb|ELQ67556.1| hypothetical protein OOW_P131scaffold00314g129 [Magnaporthe oryzae P131] gi|482812667|gb|EOA89386.1| hypothetical protein SETTUDRAFT_46231 [Setosphaeria turcica Et28A] gi|550808028|gb|ERS99941.1| 60S ribosomal protein L39 [Sporothrix schenckii ATCC 58251] gi|588894534|gb|EXF76478.1| hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] gi|607883430|gb|EZF28033.1| 60S ribosomal protein L39 [Trichophyton rubrum MR850] gi|607910227|gb|EZF47097.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 100081] gi|607922284|gb|EZF57748.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 288.86] gi|607934286|gb|EZF68319.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 289.86] gi|607946260|gb|EZF79023.1| 60S ribosomal protein L39 [Trichophyton soudanense CBS 452.61] gi|607958340|gb|EZF89637.1| 60S ribosomal protein L39 [Trichophyton rubrum MR1448] gi|607970581|gb|EZG00476.1| 60S ribosomal protein L39 [Trichophyton rubrum MR1459] gi|607976489|gb|EZG05683.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 735.88] gi|607994655|gb|EZG22078.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 202.88] Length = 51 Score = 106 bits (264), Expect = 4e-21 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHK+FRTKQKLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|EME43136.1| hypothetical protein DOTSEDRAFT_173805 [Dothistroma septosporum NZE10] Length = 51 Score = 105 bits (263), Expect = 5e-21 Identities = 49/51 (96%), Positives = 49/51 (96%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHKTFRTK KLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSHKTFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >ref|XP_003655482.1| 60S ribosomal protein L39 [Thielavia terrestris NRRL 8126] gi|347002746|gb|AEO69146.1| hypothetical protein THITE_2119222 [Thielavia terrestris NRRL 8126] Length = 51 Score = 105 bits (262), Expect = 6e-21 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHKTFRTKQKLAKA+K NRPIPQWIRLRTGNTIRYNAKRRHWRKTR+G+ Sbjct: 1 MPSHKTFRTKQKLAKAKKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGL 51 >emb|CCF37051.1| 60S ribosomal protein L39 [Colletotrichum higginsianum] Length = 51 Score = 105 bits (261), Expect = 8e-21 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHKTFRTKQKLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRK+++GI Sbjct: 1 MPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKSKLGI 51 >ref|XP_003189071.1| 60S ribosomal protein L39 [Aspergillus oryzae RIB40] Length = 51 Score = 105 bits (261), Expect = 8e-21 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHK+FRTKQKLAKAQ+ NRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSHKSFRTKQKLAKAQRQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >ref|XP_002544670.1| predicted protein [Uncinocarpus reesii 1704] gi|237904940|gb|EEP79341.1| predicted protein [Uncinocarpus reesii 1704] Length = 183 Score = 105 bits (261), Expect = 8e-21 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 82 KMPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 KMPS K+FRTKQKLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 132 KMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 183 >ref|XP_002482271.1| ribosomal protein L39e, putative [Talaromyces stipitatus ATCC 10500] gi|218718859|gb|EED18279.1| ribosomal protein L39e, putative [Talaromyces stipitatus ATCC 10500] Length = 109 Score = 105 bits (261), Expect = 8e-21 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 82 KMPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 KMPS K+FRTKQKLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 58 KMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 109 >ref|XP_959018.2| 60S ribosomal protein L39 [Neurospora crassa OR74A] gi|367027608|ref|XP_003663088.1| hypothetical protein MYCTH_2315209 [Myceliophthora thermophila ATCC 42464] gi|157069957|gb|EAA29782.2| 60S ribosomal protein L39 [Neurospora crassa OR74A] gi|336470064|gb|EGO58226.1| 60S ribosomal protein L39 [Neurospora tetrasperma FGSC 2508] gi|347010357|gb|AEO57843.1| hypothetical protein MYCTH_2315209 [Myceliophthora thermophila ATCC 42464] gi|350290244|gb|EGZ71458.1| 60S ribosomal protein L39 [Neurospora tetrasperma FGSC 2509] gi|380094182|emb|CCC08399.1| unnamed protein product [Sordaria macrospora k-hell] Length = 51 Score = 105 bits (261), Expect = 8e-21 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHKTFR KQKLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTR+G+ Sbjct: 1 MPSHKTFRVKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGL 51 >ref|XP_001229558.1| 60S ribosomal protein L39 [Chaetomium globosum CBS 148.51] gi|88183639|gb|EAQ91107.1| hypothetical protein CHGG_03042 [Chaetomium globosum CBS 148.51] Length = 51 Score = 104 bits (260), Expect = 1e-20 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHKTFR KQKLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTR+G+ Sbjct: 1 MPSHKTFRIKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGL 51 >emb|CCU76647.1| 60S ribosomal protein L39 [Blumeria graminis f. sp. hordei DH14] Length = 51 Score = 104 bits (260), Expect = 1e-20 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 MPSHK+FRTKQKLA+AQK NRPIPQWIRLRTGNTIRYN+KRRHWRKTRIGI Sbjct: 1 MPSHKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNSKRRHWRKTRIGI 51 >ref|XP_006961218.1| ribosomal protein L39e [Trichoderma reesei QM6a] gi|340522031|gb|EGR52264.1| ribosomal protein L39e [Trichoderma reesei QM6a] gi|358387104|gb|EHK24699.1| hypothetical protein TRIVIDRAFT_91630 [Trichoderma virens Gv29-8] gi|572283488|gb|ETS06462.1| ribosomal protein L39e [Trichoderma reesei RUT C-30] Length = 51 Score = 104 bits (259), Expect = 1e-20 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +1 Query: 85 MPSHKTFRTKQKLAKAQKTNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 237 M SHKTFRTKQKLAKAQK NRP+PQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MASHKTFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51