BLASTX nr result
ID: Cocculus23_contig00013284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00013284 (214 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849445.1| hypothetical protein AMTR_s00024p00063590 [A... 57 3e-06 >ref|XP_006849445.1| hypothetical protein AMTR_s00024p00063590 [Amborella trichopoda] gi|548853020|gb|ERN11026.1| hypothetical protein AMTR_s00024p00063590 [Amborella trichopoda] Length = 316 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 214 EYQKKYRKSLRDAIHSETSSHYRTFLLALV 125 EYQKKY+K L DAIHSETS HYRTFLLALV Sbjct: 283 EYQKKYKKHLEDAIHSETSGHYRTFLLALV 312