BLASTX nr result
ID: Cocculus23_contig00013083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00013083 (427 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16575.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002283799.1| PREDICTED: transcription factor Pur-alpha 1-... 62 6e-08 emb|CAN72395.1| hypothetical protein VITISV_041199 [Vitis vinifera] 62 6e-08 gb|EXB57380.1| hypothetical protein L484_016433 [Morus notabilis] 62 8e-08 gb|EYU32817.1| hypothetical protein MIMGU_mgv1a011148mg [Mimulus... 61 2e-07 gb|EYU32816.1| hypothetical protein MIMGU_mgv1a011148mg [Mimulus... 61 2e-07 ref|XP_002304844.2| hypothetical protein POPTR_0003s20690g [Popu... 61 2e-07 ref|XP_007014656.1| Transcription factor Pur-alpha 1 [Theobroma ... 61 2e-07 ref|XP_004294929.1| PREDICTED: transcription factor Pur-alpha 1-... 61 2e-07 ref|XP_002523383.1| nucleic acid binding protein, putative [Rici... 61 2e-07 ref|XP_006410345.1| hypothetical protein EUTSA_v10017021mg [Eutr... 60 2e-07 ref|XP_006445544.1| hypothetical protein CICLE_v10016090mg [Citr... 60 4e-07 gb|EMT23799.1| hypothetical protein F775_30032 [Aegilops tauschii] 60 4e-07 ref|XP_003566596.1| PREDICTED: transcription factor Pur-alpha 1-... 60 4e-07 dbj|BAJ89215.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 4e-07 ref|XP_002455393.1| hypothetical protein SORBIDRAFT_03g010090 [S... 60 4e-07 ref|NP_001141920.1| hypothetical protein [Zea mays] gi|194706458... 60 4e-07 ref|XP_002862885.1| pur ALPHA-1 [Arabidopsis lyrata subsp. lyrat... 59 5e-07 ref|NP_850182.1| transcription factor Pur-alpha 1 [Arabidopsis t... 59 5e-07 ref|NP_565736.1| transcription factor Pur-alpha 1 [Arabidopsis t... 59 5e-07 >emb|CBI16575.3| unnamed protein product [Vitis vinifera] Length = 256 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHEMVGHFVEITKDRI GMTGA+VRTV+P QR Sbjct: 224 QFHEMVGHFVEITKDRIEGMTGANVRTVDPPQR 256 >ref|XP_002283799.1| PREDICTED: transcription factor Pur-alpha 1-like [Vitis vinifera] Length = 279 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHEMVGHFVEITKDRI GMTGA+VRTV+P QR Sbjct: 247 QFHEMVGHFVEITKDRIEGMTGANVRTVDPPQR 279 >emb|CAN72395.1| hypothetical protein VITISV_041199 [Vitis vinifera] Length = 291 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHEMVGHFVEITKDRI GMTGA+VRTV+P QR Sbjct: 259 QFHEMVGHFVEITKDRIEGMTGANVRTVDPPQR 291 >gb|EXB57380.1| hypothetical protein L484_016433 [Morus notabilis] Length = 298 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHE+VGHFVEITKDRI GMTGA+VRTVEP QR Sbjct: 266 QFHEIVGHFVEITKDRIEGMTGANVRTVEPPQR 298 >gb|EYU32817.1| hypothetical protein MIMGU_mgv1a011148mg [Mimulus guttatus] Length = 290 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHEMVGHFVEITKDRI GM+GA+VRTV+P QR Sbjct: 258 QFHEMVGHFVEITKDRIEGMSGANVRTVDPPQR 290 >gb|EYU32816.1| hypothetical protein MIMGU_mgv1a011148mg [Mimulus guttatus] Length = 291 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHEMVGHFVEITKDRI GM+GA+VRTV+P QR Sbjct: 259 QFHEMVGHFVEITKDRIEGMSGANVRTVDPPQR 291 >ref|XP_002304844.2| hypothetical protein POPTR_0003s20690g [Populus trichocarpa] gi|550343648|gb|EEE79823.2| hypothetical protein POPTR_0003s20690g [Populus trichocarpa] Length = 302 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHE+VGHFVEITKDRI GMTGA+VRTV+P QR Sbjct: 270 QFHEIVGHFVEITKDRIEGMTGANVRTVDPPQR 302 >ref|XP_007014656.1| Transcription factor Pur-alpha 1 [Theobroma cacao] gi|508785019|gb|EOY32275.1| Transcription factor Pur-alpha 1 [Theobroma cacao] Length = 362 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHE+VGHFVEITKDRI GMTGA+VRTV+P QR Sbjct: 273 QFHEIVGHFVEITKDRIEGMTGANVRTVDPPQR 305 >ref|XP_004294929.1| PREDICTED: transcription factor Pur-alpha 1-like [Fragaria vesca subsp. vesca] Length = 289 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHE+VGHFVEITKDRI GMTGA+VRTV+P QR Sbjct: 257 QFHEIVGHFVEITKDRIEGMTGANVRTVDPPQR 289 >ref|XP_002523383.1| nucleic acid binding protein, putative [Ricinus communis] gi|223537333|gb|EEF38962.1| nucleic acid binding protein, putative [Ricinus communis] Length = 282 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHE+VGHFVEITKDRI GMTGA+VRTV+P QR Sbjct: 250 QFHEIVGHFVEITKDRIEGMTGANVRTVDPPQR 282 >ref|XP_006410345.1| hypothetical protein EUTSA_v10017021mg [Eutrema salsugineum] gi|557111514|gb|ESQ51798.1| hypothetical protein EUTSA_v10017021mg [Eutrema salsugineum] Length = 292 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHE++GHFVEITKDRI GMTGA+VRTV+P QR Sbjct: 260 QFHEVIGHFVEITKDRIEGMTGANVRTVDPPQR 292 >ref|XP_006445544.1| hypothetical protein CICLE_v10016090mg [Citrus clementina] gi|568871600|ref|XP_006488970.1| PREDICTED: transcription factor Pur-alpha 1-like [Citrus sinensis] gi|557548155|gb|ESR58784.1| hypothetical protein CICLE_v10016090mg [Citrus clementina] Length = 300 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHE+VGHFVEITKDRI GMTGASVR V+P QR Sbjct: 268 QFHEIVGHFVEITKDRIEGMTGASVRIVDPPQR 300 >gb|EMT23799.1| hypothetical protein F775_30032 [Aegilops tauschii] Length = 337 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHEMVGHFV+I KDR+ GMTGA+VRTVEP QR Sbjct: 305 QFHEMVGHFVDIMKDRLEGMTGANVRTVEPSQR 337 >ref|XP_003566596.1| PREDICTED: transcription factor Pur-alpha 1-like [Brachypodium distachyon] Length = 310 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHEMVGHFV+I KDR+ GMTGA+VRTVEP QR Sbjct: 278 QFHEMVGHFVDIMKDRLEGMTGANVRTVEPSQR 310 >dbj|BAJ89215.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 305 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHEMVGHFV+I KDR+ GMTGA+VRTVEP QR Sbjct: 273 QFHEMVGHFVDIMKDRLEGMTGANVRTVEPSQR 305 >ref|XP_002455393.1| hypothetical protein SORBIDRAFT_03g010090 [Sorghum bicolor] gi|241927368|gb|EES00513.1| hypothetical protein SORBIDRAFT_03g010090 [Sorghum bicolor] Length = 312 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHEMVGHFV+I KDR+ GMTGA+VRTVEP QR Sbjct: 280 QFHEMVGHFVDIMKDRLEGMTGANVRTVEPSQR 312 >ref|NP_001141920.1| hypothetical protein [Zea mays] gi|194706458|gb|ACF87313.1| unknown [Zea mays] gi|414876890|tpg|DAA54021.1| TPA: hypothetical protein ZEAMMB73_358058 [Zea mays] Length = 308 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHEMVGHFV+I KDR+ GMTGA+VRTVEP QR Sbjct: 276 QFHEMVGHFVDIMKDRLEGMTGANVRTVEPSQR 308 >ref|XP_002862885.1| pur ALPHA-1 [Arabidopsis lyrata subsp. lyrata] gi|297826667|ref|XP_002881216.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297308649|gb|EFH39144.1| pur ALPHA-1 [Arabidopsis lyrata subsp. lyrata] gi|297327055|gb|EFH57475.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 287 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHE++GHFVEITKD+I GMTGA+VRTV+P QR Sbjct: 255 QFHEVIGHFVEITKDKIEGMTGANVRTVDPPQR 287 >ref|NP_850182.1| transcription factor Pur-alpha 1 [Arabidopsis thaliana] gi|16930405|gb|AAL31888.1|AF419556_1 At2g32080/F22D22.17 [Arabidopsis thaliana] gi|330253538|gb|AEC08632.1| transcription factor Pur-alpha 1 [Arabidopsis thaliana] Length = 295 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHE++GHFVEITKD+I GMTGA+VRTV+P QR Sbjct: 263 QFHEVIGHFVEITKDKIEGMTGANVRTVDPPQR 295 >ref|NP_565736.1| transcription factor Pur-alpha 1 [Arabidopsis thaliana] gi|75206587|sp|Q9SKZ1.2|PUR_ARATH RecName: Full=Transcription factor Pur-alpha 1; AltName: Full=Purine-rich single-stranded DNA-binding protein alpha 1 gi|5081612|gb|AAD39465.1|AF136152_1 PUR alpha-1 [Arabidopsis thaliana] gi|17386138|gb|AAL38615.1|AF446882_1 At2g32080/F22D22.17 [Arabidopsis thaliana] gi|15450693|gb|AAK96618.1| At2g32080/F22D22.17 [Arabidopsis thaliana] gi|20197621|gb|AAD15396.2| putative purine-rich single-stranded DNA-binding protein [Arabidopsis thaliana] gi|330253537|gb|AEC08631.1| transcription factor Pur-alpha 1 [Arabidopsis thaliana] Length = 296 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 1 QFHEMVGHFVEITKDRIGGMTGASVRTVEPLQR 99 QFHE++GHFVEITKD+I GMTGA+VRTV+P QR Sbjct: 264 QFHEVIGHFVEITKDKIEGMTGANVRTVDPPQR 296