BLASTX nr result
ID: Cocculus23_contig00013057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00013057 (260 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDI84578.1| hypothetical protein EPH_0057750 [Eimeria praecox] 60 3e-07 >emb|CDI84578.1| hypothetical protein EPH_0057750 [Eimeria praecox] Length = 232 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/76 (38%), Positives = 49/76 (64%) Frame = -1 Query: 239 DDKSGYEGKEIENAEKDVTDAEELDKEASHEGKLKEEEKSQTDMVQPGEGEKSDSAEEGE 60 +D+ G E +E E E++ + EE ++E + E + +EEE+ + + + GE E+ + EEGE Sbjct: 16 EDEEGEEEEEGEETEEE-EEGEETEEEETEEEEEREEEEGEREEEEEGEREEEEEEEEGE 74 Query: 59 EIGQRPNENEESDKEG 12 E G+R EN+E D+EG Sbjct: 75 ETGERERENKEEDEEG 90