BLASTX nr result
ID: Cocculus23_contig00013016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00013016 (465 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280874.2| PREDICTED: retinoblastoma-related protein-li... 94 6e-22 emb|CBI20795.3| unnamed protein product [Vitis vinifera] 94 6e-22 sp|Q2ABE5.1|RBR_CAMSI RecName: Full=Retinoblastoma-related prote... 90 3e-21 ref|XP_006465771.1| PREDICTED: retinoblastoma-related protein-li... 84 1e-19 ref|XP_006432409.1| hypothetical protein CICLE_v10000128mg [Citr... 84 1e-19 ref|XP_006432412.1| hypothetical protein CICLE_v10000128mg [Citr... 84 1e-19 ref|NP_001266162.1| retinoblastoma-related protein 1 [Solanum ly... 86 1e-19 ref|XP_006340923.1| PREDICTED: retinoblastoma-related protein 1-... 83 3e-19 sp|Q9SXN6.1|RBR1_TOBAC RecName: Full=Retinoblastoma-related prot... 90 3e-19 ref|XP_004157544.1| PREDICTED: retinoblastoma-related protein-li... 85 4e-19 ref|XP_004142479.1| PREDICTED: retinoblastoma-related protein-li... 84 5e-19 sp|Q66WV0.1|RBR1_NICBE RecName: Full=Retinoblastoma-related prot... 90 8e-19 sp|O82677.1|RBR_CHERU RecName: Full=Retinoblastoma-related prote... 83 2e-18 gb|AAF61377.1|AF133675_1 retinoblastoma-related protein 1 [Popul... 82 4e-18 ref|XP_002297730.1| RETINOBLASTOMA-RELATED 1 family protein [Pop... 82 4e-18 ref|XP_004307078.1| PREDICTED: retinoblastoma-related protein-li... 83 8e-18 ref|XP_002529988.1| conserved hypothetical protein [Ricinus comm... 77 1e-17 gb|AFJ64570.1| retinoblastoma-related protein 2 [Brassica rapa] 77 2e-17 ref|XP_007010834.1| Retinoblastoma-related 1 [Theobroma cacao] g... 84 4e-17 sp|B1ABS0.1|RBR_HIEPL RecName: Full=Retinoblastoma-related prote... 83 6e-17 >ref|XP_002280874.2| PREDICTED: retinoblastoma-related protein-like [Vitis vinifera] gi|254789791|sp|A7P514.1|RBR_VITVI RecName: Full=Retinoblastoma-related protein gi|359392418|gb|AEV45768.1| RBR protein [Vitis pseudoreticulata] Length = 1007 Score = 93.6 bits (231), Expect(3) = 6e-22 Identities = 45/68 (66%), Positives = 53/68 (77%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L +VKRL+EG A Q +D+N F LCQIL+ +K N VDFFKE+PQF +KVGPIL NLYG Sbjct: 74 LYSVKRLSEGTAENVQQGNDENGFNLCQILRVSKLNIVDFFKELPQFIVKVGPILGNLYG 133 Query: 215 TDWEKRLE 238 DWEKRLE Sbjct: 134 PDWEKRLE 141 Score = 30.0 bits (66), Expect(3) = 6e-22 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L+K Sbjct: 142 AKELQANFVHLSILSK 157 Score = 26.2 bits (56), Expect(3) = 6e-22 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 1 PEEIERFWFAFI 36 PE+ ER+WFAFI Sbjct: 62 PEDSERYWFAFI 73 >emb|CBI20795.3| unnamed protein product [Vitis vinifera] Length = 1006 Score = 93.6 bits (231), Expect(3) = 6e-22 Identities = 45/68 (66%), Positives = 53/68 (77%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L +VKRL+EG A Q +D+N F LCQIL+ +K N VDFFKE+PQF +KVGPIL NLYG Sbjct: 73 LYSVKRLSEGTAENVQQGNDENGFNLCQILRVSKLNIVDFFKELPQFIVKVGPILGNLYG 132 Query: 215 TDWEKRLE 238 DWEKRLE Sbjct: 133 PDWEKRLE 140 Score = 30.0 bits (66), Expect(3) = 6e-22 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L+K Sbjct: 141 AKELQANFVHLSILSK 156 Score = 26.2 bits (56), Expect(3) = 6e-22 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 1 PEEIERFWFAFI 36 PE+ ER+WFAFI Sbjct: 61 PEDSERYWFAFI 72 >sp|Q2ABE5.1|RBR_CAMSI RecName: Full=Retinoblastoma-related protein gi|89111303|dbj|BAE80326.1| retinoblastoma related protein [Camellia sinensis] Length = 1025 Score = 89.7 bits (221), Expect(3) = 3e-21 Identities = 43/68 (63%), Positives = 51/68 (75%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L +VKRL+E NA +Q + + FTLCQIL+ K N VDFFKE+PQF +K GPIL N YG Sbjct: 84 LYSVKRLSEANADDSSQGTGGDGFTLCQILRVAKLNIVDFFKELPQFIVKAGPILSNQYG 143 Query: 215 TDWEKRLE 238 TDWEKRLE Sbjct: 144 TDWEKRLE 151 Score = 30.0 bits (66), Expect(3) = 3e-21 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L+K Sbjct: 152 AKELQANFVHLSLLSK 167 Score = 27.3 bits (59), Expect(3) = 3e-21 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 1 PEEIERFWFAFI 36 PEE ER+WFAF+ Sbjct: 72 PEEAERYWFAFV 83 >ref|XP_006465771.1| PREDICTED: retinoblastoma-related protein-like [Citrus sinensis] Length = 1024 Score = 83.6 bits (205), Expect(3) = 1e-19 Identities = 40/68 (58%), Positives = 47/68 (69%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L V+RL+E N Q S+ NEF LC IL+ K N VDFFKE+PQF +K GPIL N+YG Sbjct: 81 LYLVRRLSEKNGENLQQGSNDNEFNLCHILRVMKLNIVDFFKELPQFLVKSGPILSNIYG 140 Query: 215 TDWEKRLE 238 DWE RLE Sbjct: 141 ADWENRLE 148 Score = 30.0 bits (66), Expect(3) = 1e-19 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L+K Sbjct: 149 AKELQANFVHLSILSK 164 Score = 28.5 bits (62), Expect(3) = 1e-19 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 1 PEEIERFWFAFI 36 PEE ERFWFAF+ Sbjct: 69 PEEAERFWFAFV 80 >ref|XP_006432409.1| hypothetical protein CICLE_v10000128mg [Citrus clementina] gi|557534531|gb|ESR45649.1| hypothetical protein CICLE_v10000128mg [Citrus clementina] Length = 1024 Score = 83.6 bits (205), Expect(3) = 1e-19 Identities = 40/68 (58%), Positives = 47/68 (69%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L V+RL+E N Q S+ NEF LC IL+ K N VDFFKE+PQF +K GPIL N+YG Sbjct: 81 LYLVRRLSEKNGENLQQGSNDNEFNLCHILRVMKLNIVDFFKELPQFLVKSGPILSNIYG 140 Query: 215 TDWEKRLE 238 DWE RLE Sbjct: 141 ADWENRLE 148 Score = 30.0 bits (66), Expect(3) = 1e-19 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L+K Sbjct: 149 AKELQANFVHLSILSK 164 Score = 28.5 bits (62), Expect(3) = 1e-19 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 1 PEEIERFWFAFI 36 PEE ERFWFAF+ Sbjct: 69 PEEAERFWFAFV 80 >ref|XP_006432412.1| hypothetical protein CICLE_v10000128mg [Citrus clementina] gi|557534534|gb|ESR45652.1| hypothetical protein CICLE_v10000128mg [Citrus clementina] Length = 957 Score = 83.6 bits (205), Expect(3) = 1e-19 Identities = 40/68 (58%), Positives = 47/68 (69%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L V+RL+E N Q S+ NEF LC IL+ K N VDFFKE+PQF +K GPIL N+YG Sbjct: 14 LYLVRRLSEKNGENLQQGSNDNEFNLCHILRVMKLNIVDFFKELPQFLVKSGPILSNIYG 73 Query: 215 TDWEKRLE 238 DWE RLE Sbjct: 74 ADWENRLE 81 Score = 30.0 bits (66), Expect(3) = 1e-19 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L+K Sbjct: 82 AKELQANFVHLSILSK 97 Score = 28.5 bits (62), Expect(3) = 1e-19 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 1 PEEIERFWFAFI 36 PEE ERFWFAF+ Sbjct: 2 PEEAERFWFAFV 13 >ref|NP_001266162.1| retinoblastoma-related protein 1 [Solanum lycopersicum] gi|380710179|gb|AFD98848.1| retinoblastoma-related protein 1 [Solanum lycopersicum] Length = 1018 Score = 85.9 bits (211), Expect(3) = 1e-19 Identities = 39/68 (57%), Positives = 51/68 (75%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L +VKRL+E A + ++ N F LCQIL+ K N +DFFKE+PQF +KVGP+L NLYG Sbjct: 78 LFSVKRLSENEARNSSNGNEGNGFDLCQILRGAKLNVLDFFKELPQFIVKVGPVLSNLYG 137 Query: 215 TDWEKRLE 238 +DWEKRL+ Sbjct: 138 SDWEKRLQ 145 Score = 28.5 bits (62), Expect(3) = 1e-19 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQ NFVHL+ L+K Sbjct: 146 AKELQTNFVHLSLLSK 161 Score = 27.3 bits (59), Expect(3) = 1e-19 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = +1 Query: 1 PEEIERFWFAFI 36 PEE+ER+WF F+ Sbjct: 66 PEEVERYWFVFV 77 >ref|XP_006340923.1| PREDICTED: retinoblastoma-related protein 1-like [Solanum tuberosum] Length = 1018 Score = 83.2 bits (204), Expect(3) = 3e-19 Identities = 38/68 (55%), Positives = 50/68 (73%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L +VKRL+E A + ++ F LCQIL+ K N +DFFKE+PQF +KVGP+L NLYG Sbjct: 78 LFSVKRLSENEARNPSNGNEGKGFDLCQILRGAKLNVLDFFKELPQFIVKVGPVLSNLYG 137 Query: 215 TDWEKRLE 238 +DWEKRL+ Sbjct: 138 SDWEKRLQ 145 Score = 28.9 bits (63), Expect(3) = 3e-19 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = +1 Query: 1 PEEIERFWFAFI 36 PEE+ER+WFAF+ Sbjct: 66 PEEVERYWFAFV 77 Score = 28.5 bits (62), Expect(3) = 3e-19 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQ NFVHL+ L+K Sbjct: 146 AKELQTNFVHLSLLSK 161 >sp|Q9SXN6.1|RBR1_TOBAC RecName: Full=Retinoblastoma-related protein 1; Short=NtRb1 gi|4586799|dbj|BAA76477.1| NtRb1 [Nicotiana tabacum] Length = 961 Score = 90.1 bits (222), Expect(3) = 3e-19 Identities = 42/68 (61%), Positives = 51/68 (75%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L +VKRL+E G + ++ N F+LCQIL+ K N VDFFKE+PQF LKVGP L NLYG Sbjct: 75 LYSVKRLSEKEVGNSSNGNEGNAFSLCQILRGAKLNVVDFFKELPQFILKVGPTLSNLYG 134 Query: 215 TDWEKRLE 238 +DWEKRLE Sbjct: 135 SDWEKRLE 142 Score = 28.5 bits (62), Expect(3) = 3e-19 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQ NFVHL+ L+K Sbjct: 143 AKELQTNFVHLSLLSK 158 Score = 21.9 bits (45), Expect(3) = 3e-19 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +1 Query: 4 EEIERFWFAFI 36 E +ER+WF F+ Sbjct: 64 EGVERYWFVFV 74 >ref|XP_004157544.1| PREDICTED: retinoblastoma-related protein-like [Cucumis sativus] Length = 1125 Score = 84.7 bits (208), Expect(3) = 4e-19 Identities = 39/68 (57%), Positives = 48/68 (70%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L +VKRL + N+ Q S+ N FTLC IL+ K N V+FFKE+PQF +K GP+L NLYG Sbjct: 183 LYSVKRLRDKNSESSHQGSENNSFTLCHILRVCKLNIVEFFKELPQFVVKAGPVLSNLYG 242 Query: 215 TDWEKRLE 238 DWE RLE Sbjct: 243 ADWENRLE 250 Score = 30.0 bits (66), Expect(3) = 4e-19 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L+K Sbjct: 251 AKELQANFVHLSLLSK 266 Score = 25.4 bits (54), Expect(3) = 4e-19 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 1 PEEIERFWFAFI 36 PEE ERFW AF+ Sbjct: 171 PEEAERFWSAFV 182 >ref|XP_004142479.1| PREDICTED: retinoblastoma-related protein-like [Cucumis sativus] Length = 1024 Score = 84.3 bits (207), Expect(3) = 5e-19 Identities = 39/68 (57%), Positives = 48/68 (70%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L +VKRL + N+ Q S+ N FTLC IL+ K N V+FFKE+PQF +K GP+L NLYG Sbjct: 82 LYSVKRLRDKNSETSHQGSENNSFTLCHILRVCKLNIVEFFKELPQFVVKAGPVLSNLYG 141 Query: 215 TDWEKRLE 238 DWE RLE Sbjct: 142 ADWENRLE 149 Score = 30.0 bits (66), Expect(3) = 5e-19 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L+K Sbjct: 150 AKELQANFVHLSLLSK 165 Score = 25.4 bits (54), Expect(3) = 5e-19 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 1 PEEIERFWFAFI 36 PEE ERFW AF+ Sbjct: 70 PEEAERFWSAFV 81 >sp|Q66WV0.1|RBR1_NICBE RecName: Full=Retinoblastoma-related protein 1; Short=NbRBR1 gi|51538007|gb|AAU05979.1| retinoblastoma protein [Nicotiana benthamiana] Length = 1003 Score = 90.1 bits (222), Expect(3) = 8e-19 Identities = 43/69 (62%), Positives = 50/69 (72%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L +VKRL+E AG N F+LCQIL+ K N VDFFKE+PQF LKVGP L NLYG Sbjct: 76 LYSVKRLSEKEAGNSNNGDKGNAFSLCQILRGAKLNVVDFFKELPQFILKVGPTLSNLYG 135 Query: 215 TDWEKRLEI 241 +DWEKRLE+ Sbjct: 136 SDWEKRLEV 144 Score = 26.9 bits (58), Expect(3) = 8e-19 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 337 KELQANFVHLNFLNK 381 KELQ NFVHL+ L+K Sbjct: 145 KELQTNFVHLSLLSK 159 Score = 21.9 bits (45), Expect(3) = 8e-19 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +1 Query: 4 EEIERFWFAFI 36 E +ER+WF F+ Sbjct: 65 EGVERYWFVFV 75 >sp|O82677.1|RBR_CHERU RecName: Full=Retinoblastoma-related protein gi|3702121|emb|CAA09736.1| retinoblastoma-related protein [Oxybasis rubra] Length = 1012 Score = 83.2 bits (204), Expect(3) = 2e-18 Identities = 40/68 (58%), Positives = 49/68 (72%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L A KRL G ++ S+Q+ TLCQ LKA K N VDFFKE+PQF +K+GPIL ++YG Sbjct: 67 LYASKRLGAKTTGDASEGSNQSGITLCQKLKAVKLNLVDFFKELPQFVVKIGPILSDMYG 126 Query: 215 TDWEKRLE 238 DWEKRLE Sbjct: 127 ADWEKRLE 134 Score = 30.0 bits (66), Expect(3) = 2e-18 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L+K Sbjct: 135 AKELQANFVHLSLLSK 150 Score = 24.3 bits (51), Expect(3) = 2e-18 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 1 PEEIERFWFAFI 36 PEE+ER+ FAFI Sbjct: 55 PEELERYMFAFI 66 >gb|AAF61377.1|AF133675_1 retinoblastoma-related protein 1 [Populus tremula x Populus tremuloides] Length = 1035 Score = 81.6 bits (200), Expect(3) = 4e-18 Identities = 39/66 (59%), Positives = 45/66 (68%) Frame = +2 Query: 41 AVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYGTD 220 +VKRL+E N Q SD TLCQIL+ K N VDFFKE+P F +K GPIL N+YG D Sbjct: 96 SVKRLSEKNRDDAQQKSDDPGLTLCQILRLAKLNIVDFFKELPHFIVKAGPILSNIYGAD 155 Query: 221 WEKRLE 238 WE RLE Sbjct: 156 WENRLE 161 Score = 28.9 bits (63), Expect(3) = 4e-18 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L++ Sbjct: 162 AKELQANFVHLSILSR 177 Score = 26.2 bits (56), Expect(3) = 4e-18 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 4 EEIERFWFAFIA 39 EE ERFWFAF++ Sbjct: 83 EEAERFWFAFVS 94 >ref|XP_002297730.1| RETINOBLASTOMA-RELATED 1 family protein [Populus trichocarpa] gi|254789789|sp|B9GLX8.1|RBR_POPTR RecName: Full=Retinoblastoma-related protein gi|222844988|gb|EEE82535.1| RETINOBLASTOMA-RELATED 1 family protein [Populus trichocarpa] Length = 1035 Score = 81.6 bits (200), Expect(3) = 4e-18 Identities = 39/66 (59%), Positives = 45/66 (68%) Frame = +2 Query: 41 AVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYGTD 220 +VKRL+E N Q SD TLCQIL+ K N VDFFKE+P F +K GPIL N+YG D Sbjct: 96 SVKRLSEKNRDDAQQKSDDPGLTLCQILRLAKLNIVDFFKELPHFIVKAGPILSNIYGAD 155 Query: 221 WEKRLE 238 WE RLE Sbjct: 156 WENRLE 161 Score = 28.9 bits (63), Expect(3) = 4e-18 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L++ Sbjct: 162 AKELQANFVHLSILSR 177 Score = 26.2 bits (56), Expect(3) = 4e-18 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 4 EEIERFWFAFIA 39 EE ERFWFAF++ Sbjct: 83 EEAERFWFAFVS 94 >ref|XP_004307078.1| PREDICTED: retinoblastoma-related protein-like [Fragaria vesca subsp. vesca] Length = 1026 Score = 82.8 bits (203), Expect(3) = 8e-18 Identities = 40/68 (58%), Positives = 49/68 (72%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L +VK LNE ++ + SD N F+L QIL+A K N VDFFKE+PQF +K GPIL NLYG Sbjct: 89 LFSVKTLNEKSSDNSQKASDYNGFSLIQILRAAKLNVVDFFKELPQFIVKAGPILSNLYG 148 Query: 215 TDWEKRLE 238 DWE +LE Sbjct: 149 IDWESKLE 156 Score = 27.3 bits (59), Expect(3) = 8e-18 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 1 PEEIERFWFAFI 36 PEE ERFWF+F+ Sbjct: 77 PEEAERFWFSFV 88 Score = 25.4 bits (54), Expect(3) = 8e-18 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANF++L+ L++ Sbjct: 157 AKELQANFLYLSLLSR 172 >ref|XP_002529988.1| conserved hypothetical protein [Ricinus communis] gi|254789790|sp|B9SVG9.1|RBR_RICCO RecName: Full=Retinoblastoma-related protein gi|223530511|gb|EEF32393.1| conserved hypothetical protein [Ricinus communis] Length = 1020 Score = 77.4 bits (189), Expect(3) = 1e-17 Identities = 37/66 (56%), Positives = 44/66 (66%) Frame = +2 Query: 41 AVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYGTD 220 +VKRL+E Q D N TLCQIL+ K N VDFFKE+PQ+ +K GPIL +YG D Sbjct: 84 SVKRLSEKIRDNMQQRPDDNGLTLCQILRRAKLNIVDFFKELPQYVVKAGPILSTMYGVD 143 Query: 221 WEKRLE 238 WE RLE Sbjct: 144 WENRLE 149 Score = 28.9 bits (63), Expect(3) = 1e-17 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +1 Query: 1 PEEIERFWFAFIA 39 PEE ERFWFAF++ Sbjct: 70 PEEAERFWFAFVS 82 Score = 28.9 bits (63), Expect(3) = 1e-17 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L++ Sbjct: 150 AKELQANFVHLSILSR 165 >gb|AFJ64570.1| retinoblastoma-related protein 2 [Brassica rapa] Length = 1019 Score = 76.6 bits (187), Expect(3) = 2e-17 Identities = 33/50 (66%), Positives = 38/50 (76%) Frame = +2 Query: 89 SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYGTDWEKRLE 238 S N F LCQIL+A K N VDFFKE+PQF +K GP+LC LYG DWE RL+ Sbjct: 94 SGDNGFNLCQILRALKLNIVDFFKELPQFVVKAGPVLCELYGADWENRLQ 143 Score = 30.0 bits (66), Expect(3) = 2e-17 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L+K Sbjct: 144 AKELQANFVHLSLLSK 159 Score = 27.7 bits (60), Expect(3) = 2e-17 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 4 EEIERFWFAFI 36 EE+ERFWFAFI Sbjct: 65 EEVERFWFAFI 75 >ref|XP_007010834.1| Retinoblastoma-related 1 [Theobroma cacao] gi|508727747|gb|EOY19644.1| Retinoblastoma-related 1 [Theobroma cacao] Length = 1011 Score = 83.6 bits (205), Expect(2) = 4e-17 Identities = 39/68 (57%), Positives = 51/68 (75%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L ++K+L+E + Q SD+N FT+CQIL+ATK N VDFFKE+PQF +K GP+L +YG Sbjct: 75 LYSLKQLSEKSGENVKQGSDENGFTICQILRATKLNIVDFFKELPQFVVKAGPVLNIMYG 134 Query: 215 TDWEKRLE 238 DWE RLE Sbjct: 135 EDWESRLE 142 Score = 30.0 bits (66), Expect(2) = 4e-17 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L+K Sbjct: 143 AKELQANFVHLSLLSK 158 >sp|B1ABS0.1|RBR_HIEPL RecName: Full=Retinoblastoma-related protein gi|167593891|gb|ABZ85632.1| retinoblastoma-related protein [Hieracium pilosella] Length = 1008 Score = 82.8 bits (203), Expect(2) = 6e-17 Identities = 39/68 (57%), Positives = 51/68 (75%) Frame = +2 Query: 35 LRAVKRLNEGNAGKEAQ*SDQNEFTLCQILKATKPNAVDFFKEMPQFFLKVGPILCNLYG 214 L ++KRL++ N G++A S +N F L QIL+ K N VDFFKE+PQF +K GPIL NLYG Sbjct: 79 LFSMKRLSKKNDGEDAAKSSENSFKLYQILRVAKLNFVDFFKELPQFIVKTGPILSNLYG 138 Query: 215 TDWEKRLE 238 +DWE RL+ Sbjct: 139 SDWETRLQ 146 Score = 30.0 bits (66), Expect(2) = 6e-17 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 334 AKELQANFVHLNFLNK 381 AKELQANFVHL+ L+K Sbjct: 147 AKELQANFVHLSLLSK 162